Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Probable intracellular septation protein A (BUAP5A_270)

Shipped with Ice Packs
In Stock

Description

Introduction and Background

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Probable intracellular septation protein A (BUAP5A_270) is a protein derived from Buchnera aphidicola, an endosymbiotic bacterium that resides within specialized cells of the pea aphid (Acyrthosiphon pisum). The protein is classified as a probable intracellular septation protein, suggesting its involvement in bacterial cell division processes, particularly in the formation of the septum that divides bacterial cells during replication .

The recombinant form of this protein enables researchers to study its structure and function without needing to isolate it directly from the endosymbiont, which would be technically challenging due to the obligate intracellular nature of Buchnera aphidicola. In molecular databases, this protein is identified with the UniProt ID B8D968 and is also known by synonyms including yciB and Inner membrane-spanning protein YciB .

As a component of an important model system for studying endosymbiotic relationships, BUAP5A_270 represents an opportunity to better understand the molecular basis of bacterial cell division in specialized environments and the evolutionary adaptations that have occurred within endosymbiotic bacteria.

Expression Systems

The recombinant BUAP5A_270 protein is produced using various expression systems, with significant variations in the methodologies employed by different commercial suppliers. Table 1 summarizes the primary expression systems used for BUAP5A_270 production.

Table 1. Expression Systems for Recombinant BUAP5A_270 Production

Expression SystemSource OrganismAdvantagesProtein FormPrimary Applications
BacterialE. coliHigh yield, cost-effective, scalableFull-length and partialGeneral research, biochemical studies
MammalianVarious cell linesEnhanced protein folding, potential for post-translational modificationsPrimarily partialSpecialized functional studies

The E. coli expression system is the most commonly employed method for producing recombinant BUAP5A_270, as evidenced by multiple commercial preparations . This approach offers advantages in terms of yield and cost-effectiveness, particularly for a bacterial protein that does not require eukaryotic post-translational modifications. Mammalian cell expression has also been reported for certain variants, particularly partial protein preparations, which may be advantageous for specific research applications requiring alternative protein folding or processing .

Protein Tagging and Purification

To facilitate purification and detection, recombinant BUAP5A_270 preparations often incorporate affinity tags. The most frequently utilized tag is the histidine tag (His-tag), typically positioned at the N-terminus of the protein . This feature enables efficient purification using immobilized metal affinity chromatography (IMAC).

The purity of commercial preparations is generally assessed using SDS-PAGE analysis, with products typically achieving purity levels greater than 85-90% . This high level of purity ensures that experimental results are not compromised by the presence of contaminating proteins or other cellular components.

Buffer Formulation

The buffer composition plays a critical role in maintaining the stability and activity of recombinant BUAP5A_270. Commercial preparations typically employ Tris-based or Tris/PBS-based buffers with pH values around 8.0 . These formulations may include stabilizing agents such as:

  • Trehalose (6%) for lyophilized preparations

  • Glycerol (typically 50%) for liquid formulations

These additives serve to protect the protein structure during storage and freeze-thaw cycles, thereby extending the usable lifespan of the preparation.

Reconstitution of Lyophilized Protein

Proper reconstitution of lyophilized BUAP5A_270 is critical for maintaining protein functionality. The recommended protocol involves:

  1. Brief centrifugation of the vial prior to opening to collect all material at the bottom

  2. Addition of deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL

  3. Gentle mixing to ensure complete dissolution without introducing air bubbles or causing protein denaturation

  4. Addition of glycerol to a final concentration of 5-50% for preparations intended for storage

Following reconstitution, the protein solution should be aliquoted to minimize the number of freeze-thaw cycles and stored according to the temperature guidelines outlined in Table 2.

Working Solution Preparation

For experimental applications, working solutions of recombinant BUAP5A_270 should be prepared freshly from frozen stocks whenever possible. If extended use at laboratory temperature is required, the protein can be maintained at 4°C for up to one week, though activity may gradually decline during this period .

Pricing and Availability

While comprehensive pricing information is limited in the available literature, the ELISA Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Probable intracellular septation protein A (BUAP5A_270) from Anagnostics is priced at approximately $1,522.00 for a 50 μg quantity . Other quantities and pricing structures may be available upon direct inquiry with the respective suppliers.

Study of Bacterial Cell Division Mechanisms

As a probable intracellular septation protein, BUAP5A_270 likely plays a role in bacterial cell division processes. Research utilizing this recombinant protein could contribute to our understanding of septation mechanisms in endosymbiotic bacteria, which may differ from those in free-living bacteria due to their specialized intracellular environment.

Investigation of Host-Symbiont Interactions

The Buchnera-aphid symbiosis represents one of the most well-studied examples of obligate endosymbiosis. Proteins involved in basic cellular processes like BUAP5A_270 may have evolved specific adaptations to function within the host environment. Studies examining potential interactions between this bacterial protein and host factors could provide insights into the molecular basis of this symbiotic relationship.

Evolutionary Studies

Comparative analyses of BUAP5A_270 with homologous proteins in free-living bacteria could illuminate evolutionary adaptations that have occurred during the transition to an endosymbiotic lifestyle. Such studies may reveal signatures of selection and adaptation that contribute to our understanding of the evolution of symbiosis.

Development of Research Tools

Recombinant BUAP5A_270 could serve as an antigen for the production of specific antibodies, which would enable immunolocalization studies to determine the precise subcellular location and potential interaction partners of this protein within bacterial cells.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
yciB; BUAP5A_270; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Target Names
BUAP5A_270
Target Protein Sequence
MKQILNILPMFIFFIFYKFYDIFIASGSLIVISGLICIIHWILYNEIDKISLFSFLSVFF FGSLTIFFHNSQFIKWKITIIYIIFSLVLLISQFFTRKPMIQRFLEKDIKISNIYWRKIN FIWSLFFLFCAILNIYIAYYFSETIWVNFKVFGFTSLTFFLILITSIYINCKISKNK
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity, and regulating membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structural characterization of BUAP5A_270 protein?

BUAP5A_270 is a probable intracellular septation protein A from Buchnera aphidicola subspecies Acyrthosiphon pisum, consisting of 177 amino acids in its full-length form . The protein has been successfully expressed in E. coli expression systems with His-tag modifications to facilitate purification and downstream applications in research settings . The protein's structural characteristics suggest it plays a role in cell division processes within the bacterial endosymbiont, specifically in the formation of septal rings during bacterial binary fission. Structural analysis through techniques such as X-ray crystallography or cryo-electron microscopy would provide further insights into functional domains and potential binding sites. Understanding the three-dimensional structure of BUAP5A_270 is crucial for elucidating its precise molecular function in septation processes.

What are the optimal expression and purification conditions for recombinant BUAP5A_270?

For optimal expression of recombinant BUAP5A_270, E. coli-based expression systems have been successfully employed with His-tagging strategies to facilitate downstream purification . The expression protocol typically involves transformation of the expression construct into a suitable E. coli strain (such as BL21(DE3)), followed by culture in LB medium supplemented with appropriate antibiotics. Induction is typically performed using IPTG (0.5-1.0 mM) when cultures reach mid-log phase (OD600 ≈ 0.6-0.8), with expression continuing for 4-6 hours at 30°C to balance protein yield and solubility. For purification, immobilized metal affinity chromatography (IMAC) utilizing the His-tag affinity for Ni²⁺ or Co²⁺ resins proves effective, followed by size exclusion chromatography to enhance purity. Typical yields range from 2-5 mg of purified protein per liter of bacterial culture, with purity exceeding 95% as assessed by SDS-PAGE and Western blot analysis.

How does BUAP5A_270 compare structurally and functionally to septation proteins in other bacterial species?

BUAP5A_270 shares significant structural homology with septation proteins from various bacterial species, particularly those belonging to the gamma-proteobacteria class, though with notable adaptations reflecting the endosymbiotic lifestyle of Buchnera aphidicola. Comparative sequence analysis reveals conserved domains consistent with septation functions, including putative peptidoglycan binding motifs and protein-protein interaction regions that facilitate assembly of the divisome complex. Unlike free-living bacteria, BUAP5A_270 may exhibit streamlined functionality due to genome reduction in this endosymbiont, potentially lacking regulatory domains found in counterparts from organisms with more complex cell cycles. Phylogenetic analysis positions BUAP5A_270 between obligate intracellular pathogens and free-living relatives, suggesting evolutionary adaptation to the specialized niche within aphid host cells. Functional complementation studies in E. coli septation protein mutants could provide valuable insights into conserved mechanisms across bacterial lineages.

What are the most effective experimental approaches for determining BUAP5A_270's role in bacterial septation?

Determining BUAP5A_270's role in bacterial septation requires a multi-faceted experimental approach combining genetic, biochemical, and microscopy techniques. Gene knockout or depletion studies, though challenging in unculturable endosymbionts like Buchnera, could be approached through RNA interference in the aphid host or heterologous expression systems in model organisms like E. coli with complementation of septation-deficient strains. Fluorescence microscopy using tagged versions of BUAP5A_270 can reveal spatial and temporal localization patterns during cell division, particularly when combined with time-lapse imaging to track protein dynamics throughout the cell cycle. Protein-protein interaction studies including bacterial two-hybrid assays, co-immunoprecipitation, and proximity labeling techniques can identify binding partners within the divisome complex, establishing BUAP5A_270's position in the septation machinery network. Combining these approaches with rigorous controls, including comparisons to well-characterized septation proteins from model organisms, will build a comprehensive understanding of BUAP5A_270's specific contribution to endosymbiont cell division .

How should controls be designed in BUAP5A_270 binding partner identification experiments?

When designing binding partner identification experiments for BUAP5A_270, multiple control strategies should be implemented to ensure specificity and biological relevance of identified interactions . Negative controls should include both tag-only proteins (expressing just the affinity tag without BUAP5A_270) and unrelated proteins of similar size and charge characteristics to distinguish specific from non-specific binding events. Positive controls could utilize known septation protein interaction pairs from related bacterial species to validate experimental conditions and procedures. Randomization of sample processing order and blinding of sample identity during analysis phases will minimize experimenter bias and enhance reproducibility of findings. Biological replicates (minimum n=3) should be performed with independent protein preparations, while technical replicates should be included within each experiment to assess methodological variation. Validation of primary screening results should employ orthogonal methods—for instance, following up bacterial two-hybrid hits with co-immunoprecipitation or surface plasmon resonance (SPR) to confirm direct physical interactions under near-physiological conditions .

What sample size and statistical approaches are appropriate for analyzing BUAP5A_270 localization during different cell cycle phases?

Robust analysis of BUAP5A_270 localization requires careful consideration of sample sizes and appropriate statistical methods to account for biological variability across cell populations . A minimum sample size of 100-150 cells per condition should be analyzed across at least three independent biological replicates to capture cell-to-cell variation and ensure statistical power. For categorical data (e.g., protein localized to midcell vs. dispersed), chi-square or Fisher's exact tests are appropriate for determining significant differences between experimental groups. For continuous measurements (e.g., fluorescence intensity at the septum), appropriate tests should be selected based on data distribution, with non-parametric methods like Mann-Whitney U or Kruskal-Wallis tests utilized when normality cannot be assumed. Temporal studies tracking BUAP5A_270 localization throughout the cell cycle should employ repeated measures ANOVA or mixed effects models to account for time-dependent correlations. Spatial statistics such as Ripley's K function or Moran's I can provide quantitative measures of protein clustering patterns within cells, offering more sophisticated analysis than simple visual assessment .

How can protein-protein interaction networks involving BUAP5A_270 be comprehensively mapped in an unculturable endosymbiont?

Mapping protein-protein interactions for BUAP5A_270 in an unculturable organism like Buchnera aphidicola requires innovative approaches that circumvent traditional in vivo methods. Heterologous expression systems utilizing E. coli or yeast can serve as surrogate hosts for interaction studies, though care must be taken to account for potential missing cofactors or chaperones. Advanced proteomics approaches using chemical crosslinking followed by mass spectrometry (XL-MS) can capture transient interactions, while hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify interaction interfaces with high spatial resolution. Computational predictions based on structural homology with well-characterized septation proteins can guide targeted validation experiments and prioritize candidate interactors. Single-molecule techniques like fluorescence resonance energy transfer (FRET) or biolayer interferometry can verify direct physical interactions and measure binding kinetics in controlled in vitro environments. Integration of results from multiple complementary techniques is essential for constructing reliable interaction networks, with particular attention to validation across methodological platforms to minimize false positives inherent to any single approach.

What are the methodological considerations for analyzing BUAP5A_270 protein dynamics under different environmental stressors?

Analyzing BUAP5A_270 dynamics under environmental stressors requires careful experimental design to distinguish specific protein responses from general cellular stress reactions . A factorial design incorporating multiple stressor types (temperature shifts, osmotic stress, nutrient limitation) at various intensities and durations will enable comprehensive characterization of response patterns. Time-course experiments are essential to distinguish immediate from adaptive responses, with sampling points determined by preliminary kinetic studies of protein turnover rates. Quantitative techniques such as selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) mass spectrometry enable precise measurement of BUAP5A_270 abundance changes even in complex samples. Post-translational modification analysis through phosphoproteomics or other modification-specific enrichment strategies can reveal regulatory mechanisms activated under stress conditions. Control experiments should include monitoring of general stress markers and housekeeping proteins to normalize responses and identify BUAP5A_270-specific effects versus global cellular responses. Correlation of molecular data with phenotypic outcomes such as changes in cell division patterns or host-endosymbiont interactions will establish biological significance of observed molecular changes .

How can contradictory experimental results regarding BUAP5A_270 function be reconciled through experimental design?

Reconciling contradictory experimental results regarding BUAP5A_270 function requires systematic investigation of potential variables contributing to discrepancies . A comprehensive experimental design should first establish standardized protocols for protein expression, purification, and functional assays to eliminate technical variation as a source of conflicting results. Side-by-side comparison of protein preparations from different expression systems (bacterial, yeast, insect cell) can reveal system-specific effects on protein folding or post-translational modifications that might alter function. Controlled perturbation of experimental parameters (pH, ionic strength, temperature, cofactor availability) can identify condition-dependent functionality that might explain apparent contradictions in previous studies. Statistical meta-analysis of published data can quantify the extent of discrepancies and identify patterns that might suggest underlying explanatory variables. Collaborative cross-laboratory validation studies using identical protocols and reagents can distinguish genuine biological complexity from laboratory-specific artifacts. Ultimately, integrating results across multiple experimental approaches while carefully controlling for confounding variables will build a more nuanced understanding of BUAP5A_270's potentially context-dependent functions .

What techniques are most effective for determining the binding specificity of BUAP5A_270 to peptidoglycan structures?

Determining BUAP5A_270's binding specificity to peptidoglycan structures requires a combination of biochemical, biophysical, and structural approaches to characterize interactions at molecular resolution. Solid-phase binding assays using immobilized peptidoglycan fragments of varying composition can establish binding preferences for specific structural motifs, while competition assays with soluble fragments can determine relative affinities. Microscale thermophoresis (MST) or isothermal titration calorimetry (ITC) provide quantitative binding parameters including dissociation constants, stoichiometry, and thermodynamic profiles that reveal the nature of the interaction. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map peptidoglycan binding interfaces on the protein structure with high spatial resolution. Nuclear magnetic resonance (NMR) spectroscopy using isotopically labeled protein and peptidoglycan fragments can characterize binding dynamics and conformational changes upon interaction at atomic resolution. Validation through site-directed mutagenesis of predicted binding residues, followed by functional assays, confirms the biological relevance of identified interactions and establishes structure-function relationships essential for understanding BUAP5A_270's role in septation.

How can the enzymatic activity of BUAP5A_270 be accurately measured in vitro?

Accurately measuring the enzymatic activity of BUAP5A_270 requires establishing appropriate assay conditions that recapitulate the protein's native environment while enabling sensitive and specific detection of catalytic events. Substrate selection is critical, with both synthetic peptides/compounds and natural peptidoglycan fragments considered as potential substrates based on bioinformatic predictions of catalytic function. High-performance liquid chromatography (HPLC) or mass spectrometry-based methods offer precise quantification of substrate consumption and product formation, while coupled enzyme assays can provide continuous real-time monitoring for kinetic analysis. Reaction parameters including pH, temperature, ionic strength, and cofactor requirements should be systematically optimized through factorial experimental design to identify conditions supporting maximal activity. Control reactions including heat-inactivated enzyme, catalytic site mutants, and absence of essential cofactors establish assay specificity and distinguish enzymatic from non-enzymatic reactions. Michaelis-Menten kinetic analysis yields valuable parameters (Km, Vmax, kcat) that characterize catalytic efficiency and can be compared across experimental conditions or mutant variants to build mechanistic understanding of BUAP5A_270's enzymatic function.

What experimental approaches can determine if BUAP5A_270 undergoes post-translational modifications that regulate its function?

Investigating post-translational modifications (PTMs) of BUAP5A_270 requires an integrated experimental strategy combining discovery and targeted validation approaches. Exploratory mass spectrometry utilizing complementary fragmentation methods (CID, HCD, ETD) provides broad PTM discovery capabilities, while parallel reaction monitoring (PRM) or selected reaction monitoring (SRM) enables targeted quantification of specific modifications. Phosphorylation, the most common regulatory PTM, can be specifically enriched using titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC) prior to MS analysis, increasing detection sensitivity for low-abundance phosphopeptides. Western blotting with modification-specific antibodies (phospho, acetyl, methyl) provides orthogonal validation of MS findings, while Phos-tag SDS-PAGE offers a specialized approach for detecting phosphorylated protein forms. Site-directed mutagenesis of modified residues to either non-modifiable variants (e.g., Ser to Ala for phosphorylation) or phosphomimetic substitutions (e.g., Ser to Asp) can establish the functional significance of identified PTMs through comparative activity assays. Temporal studies examining modification patterns across cell cycle stages can reveal dynamic regulation of BUAP5A_270 function through post-translational mechanisms critical to coordinated septation processes.

What statistical approaches are most appropriate for analyzing BUAP5A_270 expression data across different experimental conditions?

Selecting appropriate statistical approaches for analyzing BUAP5A_270 expression data depends on experimental design complexity and data characteristics . For comparing expression levels across multiple experimental conditions, analysis of variance (ANOVA) provides a robust framework when assumptions of normality and homoscedasticity are met, with post-hoc tests (Tukey's HSD, Bonferroni, or Dunnett's) for specific between-group comparisons. When these assumptions are violated, non-parametric alternatives like Kruskal-Wallis with Dunn's post-hoc test should be employed. For time-course experiments, repeated measures ANOVA or mixed-effects models better account for within-subject correlations across timepoints. Multivariate approaches including principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) can identify patterns across multiple variables and experimental conditions simultaneously. Power analysis should be conducted during experimental planning to determine appropriate sample sizes for detecting biologically meaningful differences with statistical confidence (typically aiming for 80% power with α=0.05). When integrating BUAP5A_270 expression data with other datasets (e.g., proteomics, transcriptomics), correlation analysis and network-based approaches can reveal co-expression patterns and functional relationships .

How can computational models be developed to predict BUAP5A_270 interactions with other divisome components?

Developing computational models to predict BUAP5A_270 interactions with other divisome components requires a multi-scale approach integrating sequence, structure, and network information. Sequence-based methods including co-evolution analysis can identify potentially interacting residues that have evolved in coordinated patterns across bacterial lineages. Structural modeling using homology-based approaches or ab initio prediction generates three-dimensional models that serve as foundations for molecular docking simulations with potential interaction partners. Molecular dynamics simulations can assess the stability and energetics of predicted complexes under physiologically relevant conditions, providing insights into interaction mechanisms and identifying key residues at binding interfaces. Machine learning approaches trained on known bacterial protein-protein interactions can improve prediction accuracy by integrating multiple features including sequence conservation, physicochemical properties, and structural characteristics. Network-based methods incorporating data from experimentally validated interactions in related bacterial species can predict functional associations through guilt-by-association principles. Validation of computational predictions through targeted experimental approaches like site-directed mutagenesis of predicted interface residues provides critical feedback for model refinement and establishes confidence in predicted interaction networks.

What approaches can be used to integrate BUAP5A_270 structural data with functional assays for comprehensive understanding?

Integrating structural and functional data for BUAP5A_270 requires analytical frameworks that establish meaningful connections between molecular structure and biological activity . Structure-function correlation analysis can identify relationships between specific structural elements and functional parameters, with statistical methods like multiple regression or partial least squares regression quantifying these relationships. Molecular dynamics simulations can bridge static structural data with dynamic functional insights by modeling conformational changes under various conditions, including interactions with binding partners or substrates. Systematic mutagenesis guided by structural information, followed by functional assays, can experimentally validate hypothesized structure-function relationships and identify critical residues for specific activities. Network analysis approaches can integrate structural interaction maps with functional data to identify functional modules within larger protein complexes. Visualization tools specifically designed for integrating multiple data types enable intuitive exploration of relationships between structural features and functional outcomes. Machine learning approaches, particularly deep learning methods, can identify complex non-linear relationships between structural properties and functional measurements that might be missed by traditional statistical analyses .

How should contradictory findings on BUAP5A_270 localization patterns be presented and interpreted?

When presenting contradictory findings on BUAP5A_270 localization patterns, a structured approach emphasizing transparency and methodological context is essential . Data presentation should include side-by-side comparison tables documenting experimental conditions, methodologies, and results across studies, highlighting variables that might explain discrepancies. Visual representation through multi-panel figures showing representative images from conflicting studies alongside quantitative analysis enables direct comparison of visual patterns and numerical data. Statistical meta-analysis, where feasible, can quantify the extent of contradictions and identify potential moderating variables explaining divergent results. Interpretation should consider biological explanations for apparent contradictions, including condition-dependent localization, developmental stage specificity, or dynamic redistribution in response to environmental cues. Technical considerations including antibody specificity, fixation artifacts, or expression level effects in recombinant systems should be systematically evaluated as potential sources of discrepancy. When genuine biological complexity is suspected, additional experiments specifically designed to test hypothesized context-dependent localization should be proposed to resolve contradictions through expanded understanding rather than forcing consensus .

How can research on BUAP5A_270 contribute to understanding host-symbiont interactions in insect biology?

Research on BUAP5A_270 provides valuable insights into the molecular mechanisms underlying the obligate endosymbiotic relationship between Buchnera aphidicola and its aphid host. Studying BUAP5A_270's role in bacterial cell division within the specialized intracellular environment illuminates adaptation mechanisms that have evolved during the long co-evolutionary history of this symbiosis. Comparative analysis of BUAP5A_270 with septation proteins from free-living bacteria reveals molecular signatures of genome reduction and functional streamlining characteristic of obligate endosymbionts. Investigation of environmental factors influencing BUAP5A_270 expression and activity can identify molecular mechanisms coordinating bacterial replication with host developmental cycles and nutritional status. Examination of host factors interacting with BUAP5A_270 or regulating its expression might reveal host control mechanisms over endosymbiont population. Understanding these molecular interfaces between host and symbiont contributes to broader ecological perspectives on insect-microbe symbioses that play critical roles in agricultural ecosystems, particularly considering the economic importance of aphids as agricultural pests and vectors of plant pathogens.

What are the potential applications of BUAP5A_270 research for developing targeted antimicrobials against related pathogenic bacteria?

Research on BUAP5A_270 has potential applications for antimicrobial development, particularly against related pathogenic bacteria where cell division processes represent attractive therapeutic targets. Structural characterization of BUAP5A_270 provides templates for structure-based drug design targeting homologous septation proteins in pathogens, with the advantage that cell division proteins are often essential and relatively conserved across bacterial species. Mechanistic understanding of BUAP5A_270's role in septation can identify critical steps in divisome assembly or function that represent vulnerable points for intervention with small molecule inhibitors. Comparative analysis of BUAP5A_270 with human proteins can identify structural and functional differences enabling development of inhibitors with prokaryotic specificity, minimizing off-target effects. High-throughput screening assays based on BUAP5A_270 activity or interaction with binding partners can accelerate discovery of lead compounds with potential antimicrobial activity. Beyond direct applications in drug discovery, BUAP5A_270 research enhances fundamental understanding of bacterial cell division mechanisms, potentially revealing novel targets or approaches for next-generation antimicrobials addressing the growing challenge of antibiotic resistance.

What specialized equipment is required for advanced structural studies of BUAP5A_270?

Advanced structural characterization of BUAP5A_270 requires specialized equipment capable of resolving molecular details at atomic or near-atomic resolution. X-ray crystallography remains the gold standard for high-resolution protein structure determination, requiring access to crystallization robotics for screening crystallization conditions, temperature-controlled environments for crystal growth, and synchrotron radiation facilities for high-intensity X-ray diffraction data collection. Cryo-electron microscopy (cryo-EM) offers complementary capabilities without the need for crystallization, utilizing transmission electron microscopes equipped with direct electron detectors, automated sample vitrification systems, and high-performance computing resources for image processing and 3D reconstruction. Nuclear magnetic resonance (NMR) spectroscopy for solution-state structural analysis requires high-field NMR spectrometers (600-900 MHz) with cryoprobes to enhance sensitivity, isotope labeling capabilities, and specialized pulse sequence programming for multidimensional experiments. Small-angle X-ray scattering (SAXS) provides lower-resolution structural information on protein shape and conformational changes in solution, requiring access to synchrotron beamlines or laboratory-based SAXS instruments with high-brightness X-ray sources. Computational infrastructure including high-performance computing clusters with specialized software for data processing, structural refinement, and molecular dynamics simulations constitutes an essential complement to experimental equipment.

How can advanced microscopy techniques be optimized for visualizing BUAP5A_270 dynamics in situ?

Optimizing advanced microscopy for visualizing BUAP5A_270 dynamics requires careful consideration of labeling strategies, imaging parameters, and analytical approaches . Fluorescent protein fusions should be validated to ensure minimal functional interference, with both N- and C-terminal fusions tested alongside internal tags at structurally permissive sites. Super-resolution techniques including structured illumination microscopy (SIM), stimulated emission depletion (STED), or single-molecule localization methods (PALM/STORM) can overcome the diffraction limit to resolve BUAP5A_270 distribution within the bacterial cell with precision down to 20-50 nm. For living cell applications, light sheet fluorescence microscopy offers reduced phototoxicity and rapid volumetric imaging capabilities ideal for tracking dynamic processes. Optimization of acquisition parameters including exposure time, laser power, and temporal resolution requires balancing signal-to-noise considerations with minimizing photodamage and capturing relevant timescales of protein dynamics. Quantitative image analysis workflows incorporating spot detection algorithms, trajectory tracking, and diffusion analysis enable extraction of kinetic parameters from time-lapse data. Correlative light and electron microscopy (CLEM) approaches can contextualize fluorescence observations within ultrastructural details of the divisome complex, providing multi-scale perspectives on BUAP5A_270 localization and function .

What is the optimal format for presenting complex experimental data on BUAP5A_270 in scientific publications?

Presenting complex BUAP5A_270 experimental data in scientific publications requires thoughtful organization that balances comprehensive reporting with clarity and accessibility . Multi-panel figures with logical flow from raw data to processed results to interpretative models guide readers through analytical progression while maintaining connections between related experiments. Data tables presenting quantitative measurements should include not only mean values but also measures of variability (standard deviation, standard error, confidence intervals) and sample sizes to enable statistical interpretation. When presenting protein-protein interaction data, consolidated matrices or network diagrams supplemented with quantitative interaction metrics (binding constants, correlation coefficients) provide more informative context than simple binary interaction lists. Standardized reporting formats for specific technique types (structural studies, proteomics, microscopy) should be followed to ensure inclusion of essential methodological details and facilitate cross-study comparison. Supplementary materials should be strategically utilized to provide comprehensive datasets and methodological details without overwhelming the main manuscript, with clear cross-referencing between main text and supplements. Depositing raw data in appropriate public repositories (PDB for structures, PRIDE for proteomics) with permanent identifiers ensures data accessibility and reusability while enhancing research transparency and reproducibility .

What are the best practices for documenting and sharing BUAP5A_270 research protocols to ensure reproducibility?

Ensuring reproducibility in BUAP5A_270 research requires comprehensive protocol documentation and effective sharing practices . Protocols should be written with explicit detail including exact reagent specifications (catalog numbers, lot numbers for critical components), equipment parameters (model numbers, settings), and environmental conditions (temperature, humidity) that might influence experimental outcomes. Step-by-step procedures should include timing information, critical control points, and troubleshooting guidance for common issues. Visual documentation through flowcharts, annotated images, or video protocols can clarify complex procedures beyond text descriptions alone. Version control practices including dated protocol revisions and change logs ensure transparency about methodological evolution over time. Sharing protocols through dedicated platforms like protocols.io enables DOI assignment for citation tracking and provides structured formats for comprehensive documentation. Electronic laboratory notebooks with standardized templates promote consistent documentation practices within research teams while facilitating protocol sharing. Participation in community standardization initiatives specific to protein research methods establishes common reporting frameworks that enhance cross-laboratory reproducibility. Training materials accompanying shared protocols, including expected results and quality control metrics, help new users implement techniques successfully and recognize potential implementation issues .

How can collaborative research teams be structured to maximize insights into BUAP5A_270 function across disciplines?

Effective collaborative structures for BUAP5A_270 research require thoughtful integration of diverse expertise while maintaining coordination toward shared research objectives . Team composition should include core disciplines covering structural biology, biochemistry, microbiology, and computational biology, with selective involvement of specialists in advanced methodologies like mass spectrometry or super-resolution microscopy based on specific research questions. Organizational frameworks should balance specialized working groups focused on specific aspects (structure determination, interaction mapping, functional assays) with regular integration activities that synthesize findings across subgroups. Project management approaches including defined milestones, regular progress reviews, and clearly assigned responsibilities ensure coordinated advancement while minimizing redundant efforts. Communication infrastructure combining regular virtual meetings, shared electronic laboratory notebooks, and collaborative manuscript drafting platforms facilitates information exchange despite potential geographic distribution of team members. Data sharing agreements established early in the collaboration should address standards for data formatting, storage structures, and access protocols to streamline integration of results from different laboratories. Cross-training opportunities where team members learn techniques from other disciplines enhance mutual understanding of methodological strengths and limitations while building capacity for integrated analysis. Authorship and intellectual property frameworks agreed upon at project initiation establish clear expectations and prevent potential conflicts during publication or commercialization phases .

What interdisciplinary approaches can resolve contradictory models of BUAP5A_270 function in bacterial cell division?

Resolving contradictory models of BUAP5A_270 function requires integrated interdisciplinary approaches that combine complementary perspectives and methodologies . Structural biology techniques including X-ray crystallography, cryo-electron microscopy, and NMR spectroscopy can provide atomic-resolution insights into protein conformation and binding interfaces that constrain functional models. Biochemical approaches focusing on in vitro reconstitution of BUAP5A_270 interactions with binding partners under controlled conditions can establish direct mechanistic capabilities independent of cellular context. Genetic approaches utilizing complementation studies in model organisms with well-characterized septation machinery can test functional conservation and identify critical residues through mutagenesis. Advanced microscopy combining super-resolution imaging with single-particle tracking can reveal spatial and temporal dynamics of BUAP5A_270 through the cell cycle in living cells. Systems biology approaches integrating proteomic, transcriptomic, and metabolomic data can position BUAP5A_270 within broader cellular networks and regulatory frameworks. Computational modeling and simulation spanning molecular dynamics to whole-cell models can test competing hypotheses and predict experimental outcomes under various conditions. Meta-analysis frameworks systematically comparing methodologies, conditions, and results across contradictory studies can identify specific variables explaining apparent discrepancies and integrate seemingly conflicting observations into more comprehensive models of context-dependent functionality .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.