Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Probable intracellular septation protein A (BUAPTUC7_272)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing the order. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; BUAPTUC7_272; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
Target Names
BUAPTUC7_272
Target Protein Sequence
MKQILNILPMFIFFIFYKFYDIFIASGSLIVISGLICIIHWIFYNEIDKISLFSFLSVFF FGSLTIFFHNSQFIKWKITIIYIIFSLVLLISQFFTRKPMIQRFLEKDIKISNIYWRKIN FIWSLFFLFCAILNIYIAYYFSETIWVNFKVFGFTSLTFFLILITSIYINCKISKNK
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is BUAPTUC7_272 and what is its predicted function?

BUAPTUC7_272, also known as YciB or Inner membrane-spanning protein YciB, is a probable intracellular septation protein A found in Buchnera aphidicola, an obligate endosymbiotic bacterium of aphids. The protein consists of 177 amino acids and is predicted to be involved in cell septation processes during bacterial division. Based on its sequence characteristics, it appears to be an integral membrane protein with multiple transmembrane domains, as evidenced by its hydrophobic amino acid composition and the presence of membrane-spanning regions in its sequence . This localization suggests its involvement in membrane-associated processes critical for Buchnera's cellular function within the specialized host bacteriocyte cells.

What expression systems are most effective for recombinant production of BUAPTUC7_272?

Multiple expression systems have been successfully used for the recombinant production of BUAPTUC7_272, each with specific advantages for different experimental contexts:

Expression SystemAdvantagesConsiderationsTag Options
E. coliHigh yield, cost-effective, rapid expressionMay need optimization for membrane proteinsN-terminal 10xHis-tag , Avi-tag Biotinylated
YeastBetter for eukaryotic post-translational modificationsLonger production timeVarious tags available
BaculovirusHigh yield of properly folded complex proteinsMore complex systemVarious tags available
Mammalian cellsOptimal for complex eukaryotic proteinsMost expensive, lower yieldVarious tags available

For membrane proteins like BUAPTUC7_272, E. coli systems have been successfully employed with specific measures to optimize membrane protein expression, including the use of specialized strains and expression conditions . The choice of expression system should be guided by the specific experimental requirements, including downstream applications and structural analysis needs.

What purification strategies are recommended for recombinant BUAPTUC7_272?

Since BUAPTUC7_272 is a membrane protein, purification requires specialized approaches:

  • Membrane isolation and solubilization: First isolate bacterial membranes through differential centrifugation, then solubilize the membrane proteins using appropriate detergents (typically mild non-ionic detergents like DDM or LDAO).

  • Affinity chromatography: Utilize the N-terminal 10xHis-tag for immobilized metal affinity chromatography (IMAC) . For biotinylated versions, streptavidin affinity chromatography is highly effective .

  • Size exclusion chromatography: Further purify the protein and assess its oligomeric state through size exclusion chromatography while maintaining it in suitable detergent micelles.

  • Buffer optimization: For maximum stability, the purified protein should be maintained in Tris-based buffer with 6% trehalose at pH 8.0, and potentially supplemented with 50% glycerol for long-term storage .

The purification should achieve >85% purity as assessed by SDS-PAGE . For structural studies, additional purification steps may be necessary to achieve higher purity.

How can researchers functionally characterize BUAPTUC7_272?

Functional characterization of BUAPTUC7_272 presents unique challenges given its predicted role in septation and its origin from an uncultivable endosymbiont. Recommended approaches include:

  • Reconstitution into liposomes: Incorporate purified protein into artificial membrane systems to assess its impact on membrane dynamics and properties.

  • Complementation studies: Express BUAPTUC7_272 in bacterial strains with deletions of homologous septation proteins to assess functional complementation.

  • Protein-protein interaction studies: Use techniques such as bacterial two-hybrid systems, pull-down assays, or proximity labeling approaches to identify interaction partners within the septation machinery.

  • Localization in heterologous systems: Express fluorescently tagged versions in model bacteria to confirm septal localization during cell division.

  • Structural analysis: Apply techniques like cryo-electron microscopy or X-ray crystallography specifically optimized for membrane proteins to determine structural features related to function.

Similar approaches have been successfully used for studying flagellar basal body proteins in Buchnera, demonstrating their feasibility for this challenging system .

How might BUAPTUC7_272 contribute to the aphid-Buchnera symbiosis?

BUAPTUC7_272, as a probable septation protein, likely plays a critical role in regulating Buchnera cell division within aphid bacteriocytes. This function has important implications for symbiosis maintenance:

  • Population control: Proper septation is essential for maintaining appropriate Buchnera titers within host cells. Transcriptome analyses have revealed that other Buchnera membrane proteins show differential expression in aphid lines with different Buchnera population densities .

  • Spatial organization: The organization of Buchnera cells within the bacteriocyte may influence metabolic exchange efficiency. The septation process likely contributes to the characteristic dense packing of Buchnera cells (approximately 2.7 μm in diameter) within the large bacteriocytes (approximately 133.9 μm in diameter) .

  • Interface with host structures: As a membrane protein, BUAPTUC7_272 may participate in structuring the bacterial membrane in ways that optimize interaction with the host-derived symbiosomal membrane, potentially facilitating nutrient exchange across these boundaries.

The fact that Buchnera has retained this protein despite massive genome reduction suggests it performs functions essential to symbiotic success beyond basic cell division.

What methods can be used to study BUAPTUC7_272 in the context of intact symbiosis?

Studying BUAPTUC7_272 in its native symbiotic context requires specialized approaches for this uncultivable endosymbiont:

  • Immunolocalization: Using specific antibodies against BUAPTUC7_272 to visualize its distribution within bacteriocytes. This approach has been successfully used for other proteins in this system, revealing their precise subcellular localization .

  • Transcriptomics and proteomics: Analyzing expression patterns of BUAPTUC7_272 under different physiological conditions or developmental stages of the aphid host to understand regulation.

  • Comparative approaches: Comparing BUAPTUC7_272 function across different aphid lineages with varying Buchnera titers to correlate protein activity with symbiont population dynamics.

  • Bacteriocyte isolation techniques: Isolating intact bacteriocytes (as described for ApGLNT1 localization studies) provides a way to obtain Buchnera cells in their native context for downstream analyses .

  • RNA interference in aphids: While not directly targeting Buchnera genes, RNAi targeting aphid genes involved in bacteriocyte formation or maintenance can help understand the cellular context in which BUAPTUC7_272 functions.

How does BUAPTUC7_272 compare to homologous proteins in free-living bacteria?

BUAPTUC7_272 belongs to the YciB family of proteins found across many bacterial species. Comparative analysis reveals:

  • Structural conservation: The core transmembrane domains show conservation with free-living relatives, suggesting preserved structural features essential for membrane integration.

  • Functional divergence: While YciB proteins in free-living bacteria often function in cell division and membrane integrity, the Buchnera version may have adapted to the specific constraints of endosymbiotic life.

  • Interaction network differences: In free-living bacteria, YciB proteins typically interact with a complete set of division proteins. In Buchnera, with its reduced genome, BUAPTUC7_272 likely functions within a simplified protein interaction network.

  • Evolutionary rate: Comparative genomic analysis could reveal whether BUAPTUC7_272 shows accelerated evolution compared to free-living counterparts, which would suggest adaptive specialization to the endosymbiotic lifestyle.

This comparative approach provides insight into how essential bacterial processes have been modified during the evolution of obligate endosymbiosis.

How does BUAPTUC7_272 relate to nutrient exchange in the aphid-Buchnera symbiosis?

While BUAPTUC7_272 is not directly involved in nutrient transport, its role in maintaining Buchnera cellular integrity has implications for the nutritional symbiosis:

The substrate feedback inhibition model proposed for amino acid biosynthesis regulation requires proper structural organization of the symbiosis at the cellular level, a process in which BUAPTUC7_272 likely plays a supporting role.

What are the major challenges in working with recombinant BUAPTUC7_272?

Researchers working with BUAPTUC7_272 face several technical challenges:

  • Membrane protein solubility: As an integral membrane protein, BUAPTUC7_272 presents challenges in expression, solubilization, and purification. Careful detergent selection is crucial for maintaining protein structure and function.

  • Protein stability: The protein requires specific storage conditions (Tris/PBS-based buffer with 6% trehalose, pH 8.0) to maintain stability . Even with proper storage, repeated freeze-thaw cycles should be avoided.

  • Functional assays: Developing appropriate assays to measure the septation activity of BUAPTUC7_272 is challenging due to its specialized function and the inability to culture Buchnera.

  • Native context recreation: Creating experimental systems that adequately mimic the symbiosomal environment is difficult but essential for understanding authentic function.

  • Protein-protein interactions: Identifying interaction partners is complicated by the reduced genome of Buchnera and the specialized symbiotic context in which BUAPTUC7_272 functions.

How can researchers optimize antibody development for BUAPTUC7_272 studies?

Effective antibodies are crucial for studying BUAPTUC7_272 in its native context:

  • Epitope selection: Choose epitopes from predicted extramembrane loops for higher accessibility in immunodetection. Avoid highly conserved regions that might cross-react with host proteins.

  • Validation strategies: Validate antibody specificity using recombinant protein expressed with different tags . Include appropriate controls such as peptide-preadsorbed primary antibodies as demonstrated in ApGLNT1 immunolocalization studies .

  • Application optimization: Different fixation and permeabilization protocols may be needed for immunolocalization of membrane proteins in bacteriocytes versus Western blot applications.

  • Cross-species considerations: When studying BUAPTUC7_272 across different Buchnera strains, consider epitope conservation to ensure consistent detection.

  • Quantitative applications: For quantifying protein levels, consider developing calibrated immunoassays using purified recombinant protein as standards.

Properly validated antibodies enable crucial experiments including localization studies, protein expression analysis, and co-immunoprecipitation to identify interaction partners.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.