Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Protein-export membrane protein SecG (secG)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Protein-export Membrane Protein SecG (secG)

Recombinant SecG (accession: P57460) is a membrane protein critical for protein secretion in Buchnera aphidicola, the obligate endosymbiont of pea aphids (Acyrthosiphon pisum). It belongs to the Sec system, which is essential for translocating nascent proteins across bacterial membranes. SecG functions as a subunit of the SecYEG translocase complex, facilitating the export of proteins synthesized by Buchnera to support its symbiotic relationship with aphids .

Role in Protein Secretion

SecG interacts with SecY and SecE to form the translocase complex, enabling the export of proteins synthesized in the cytoplasm or on ribosomes bound to the membrane. In Buchnera, this system is vital for maintaining symbiosis, as the bacterium provides essential amino acids (AAs) to aphids .

Evolutionary Conservation

Genomic analyses of Buchnera reveal reduced genome sizes (e.g., 452,999 bp in B. aphidicola BCt) but retention of essential genes like secG, indicating its conserved role . Comparative studies across aphid subfamilies show secG is consistently present, underscoring its functional necessity .

Experimental Tools

Recombinant SecG is used in:

  • ELISA Development: Detecting SecG expression in Buchnera or host-aphid interactions .

  • Structural Studies: Investigating membrane protein folding and translocase assembly .

  • Symbiosis Research: Exploring host-symbiont interactions, particularly in nutrient exchange .

Limitations

  • Functional Studies: Direct evidence of SecG’s role in Buchnera’s nutrient provisioning remains limited, as most research focuses on SecA, SecB, or YidC .

  • Host-Specificity: Recombinant SecG from Buchnera aphidicola subsp. Schizaphis graminum (Uniprot: Q8K9G9) shows divergent AA sequences, highlighting subspecies-specific adaptation .

Host Systems and SecG Expression

Host SystemPurityExpression RegionSource
E. coli≥85%Full-length (1–109 aa)
Yeast≥85%Partial
Cell-Free Expression≥85%Full-length

AA Sequence Comparison

SubspeciesAA Sequence Segment
Acyrthosiphon pisum (APS)MYLFFLIVFIFISFSLIFFILLQPGKGLNNTVHSHTKNNIKFFNSIGTNNFITKIIKILA...
Schizaphis graminum (Sg)MYLFFLIFLIFISFSLIFLILLQSGKGFNNTIHLNTSNNFNFFNSVGSGGFIKNIIGFFA...

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can serve as a reference for your own usage.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
secG; BU380; Protein-export membrane protein SecG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
secG
Target Protein Sequence
MYLFFLIVFIFISFSLIFFILLQPGKGLNNTVHSHTKNNIKFFNSIGTNNFITKIIKILA FFFLLISIILCNINSKRIDSDFFWEDNQNNTITKKHVLDKKKLNLDIPN
Uniprot No.

Target Background

Function
This protein is involved in protein export and participates in an early stage of protein translocation.
Database Links

KEGG: buc:BU380

STRING: 107806.BU380

Protein Families
SecG family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of the SecYEG translocon in Buchnera aphidicola?

The SecYEG translocon in Buchnera aphidicola consists of three core components: SecY, SecE, and SecG. This heterotrimeric complex forms a passive and sealed pore connecting the cytoplasm to the periplasm and the lipid phase of the membrane. Despite Buchnera's genome reduction, the SecYEG translocon maintains its essential structure to facilitate protein transport across the inner bacterial membrane. To investigate this structure, researchers should employ:

  • Comparative structural analysis with homologous SecYEG complexes from model organisms like Escherichia coli

  • Membrane protein isolation techniques optimized for small bacterial cells

  • Cryo-electron microscopy or X-ray crystallography for structural determination

  • Computational modeling to predict structural features based on conserved domains

How does SecG contribute to protein translocation in Buchnera aphidicola?

SecG functions as an essential component of the SecYEG translocon that facilitates the insertion of membrane proteins into the inner membrane and the translocation of proteins across the inner membrane into the periplasm. In Buchnera aphidicola, SecG works in coordination with SecY and SecE to form the channel through which proteins are transported. To study SecG's specific contribution:

  • Generate recombinant SecG protein and assess its membrane integration properties

  • Perform site-directed mutagenesis to identify critical functional residues

  • Use in vitro reconstitution assays with purified components to measure translocation efficiency

  • Deploy fluorescently labeled substrates to track protein movement through the translocon in real-time

What expression systems are most suitable for producing recombinant Buchnera aphidicola SecG protein?

For successful expression of recombinant Buchnera aphidicola SecG protein, researchers should consider:

  • E. coli-based expression systems optimized for membrane proteins, such as C41(DE3) or C43(DE3) strains

  • Codon optimization based on the high A+T content characteristic of Buchnera genes

  • Fusion tags that enhance solubility while maintaining functionality (such as maltose-binding protein or SUMO tags)

  • Temperature-controlled expression protocols to prevent inclusion body formation

  • Membrane-mimetic environments for proper folding and stabilization during purification

How does genome reduction in Buchnera affect the conservation of SecG and the protein translocation system?

Despite extensive genome reduction in Buchnera aphidicola, the SecG protein and other components of the protein translocation machinery remain conserved, highlighting their essential functions. The ancestral genome contained approximately 2,425 open reading frames (ORFs), while Buchnera's genome has only 564 ORFs. To investigate the effects of this genome reduction:

  • Conduct comparative genomic analyses across different Buchnera strains to identify conservation patterns of secG and related genes

  • Examine syntenic regions surrounding secG to understand gene neighborhood conservation

  • Analyze regulatory elements upstream of secG to determine how expression control may have evolved

  • Compare sequence conservation of secG relative to other essential genes to assess selective pressure

How do interactions between SecG and other Sec proteins differ in Buchnera compared to free-living bacteria?

In Buchnera aphidicola, the interactions between SecG and other components of the Sec machinery may have adapted to the symbiotic lifestyle and reduced genomic context. To investigate these specialized interactions:

  • Perform co-immunoprecipitation studies using antibodies against recombinant SecG to identify interacting partners in Buchnera

  • Use bacterial two-hybrid systems to map protein-protein interactions between SecG and other components

  • Conduct cross-linking experiments followed by mass spectrometry to identify transient interactions during protein translocation

  • Develop comparative interaction maps between Buchnera SecG and E. coli SecG to identify conserved and divergent interaction networks

What are the implications of regulatory element loss in Buchnera on SecG expression and function?

Buchnera aphidicola has experienced significant loss of regulatory elements, including promoters and Shine-Dalgarno sequences. For secG and the sec operon, this regulatory evolution may affect expression patterns. To address this question:

  • Analyze the intergenic regions upstream of secG to identify remnants of ancestral regulatory elements

  • Compare the Shine-Dalgarno sequences of secG with those in E. coli to assess potential translation efficiency differences

  • Use RNA-seq to determine if secG is co-transcribed with other genes in polycistronic units resulting from genome rearrangements

  • Perform quantitative RT-PCR to measure secG expression levels under different physiological conditions

How has the evolutionary history of secG in Buchnera been influenced by its endosymbiotic lifestyle?

The evolutionary trajectory of secG in Buchnera aphidicola has been shaped by its long-term endosymbiotic relationship with aphids. To explore this evolutionary history:

  • Conduct phylogenetic analyses of secG across different Buchnera strains from various aphid hosts

  • Calculate selective pressure (dN/dS ratios) on secG to determine if it is under purifying, neutral, or positive selection

  • Analyze syntenic regions containing secG across different Buchnera strains to identify patterns of genomic rearrangement

  • Examine potential horizontal gene transfer events by comparing secG sequences with those from related bacteria

What methodological approaches can overcome the challenges of studying protein transport in an uncultivable endosymbiont like Buchnera?

Buchnera aphidicola cannot be cultured outside its aphid host, presenting unique challenges for experimental research. Advanced methodologies to overcome these limitations include:

  • Develop cell-free protein synthesis systems using Buchnera components to study SecG function in vitro

  • Use heterologous expression of Buchnera SecG in model organisms like E. coli for functional complementation studies

  • Implement microinjection techniques to deliver experimental constructs directly into aphid bacteriocytes

  • Apply advanced microscopy techniques such as FRAP (Fluorescence Recovery After Photobleaching) to study protein transport dynamics in intact bacteriocytes

  • Utilize computational approaches to model SecG function based on sequence data and structural predictions

Protocols for isolation and characterization of recombinant Buchnera SecG

To effectively isolate and characterize recombinant Buchnera SecG protein:

  • Clone the secG gene from Buchnera aphidicola subsp. Acyrthosiphon pisum, incorporating appropriate affinity tags

  • Express in E. coli strains optimized for membrane proteins (C41/C43)

  • Extract using detergent solubilization methods optimized for small membrane proteins

  • Purify using affinity chromatography followed by size exclusion chromatography

  • Verify protein identity using mass spectrometry and Western blotting

  • Assess protein folding using circular dichroism spectroscopy

  • Reconstitute purified SecG into liposomes for functional assays

Comparative genomics approaches for understanding SecG evolution in Buchnera

Comparative genomics provides valuable insights into the evolutionary history of secG in Buchnera aphidicola:

  • Extract secG sequences from all available Buchnera genomes

  • Align sequences using programs optimized for highly conserved genes (MUSCLE, MAFFT)

  • Construct phylogenetic trees using maximum likelihood or Bayesian methods

  • Map genomic context surrounding secG across different Buchnera strains

  • Compare with secG from free-living relatives to identify Buchnera-specific adaptations

  • Analyze selection pressure using PAML or similar tools to calculate dN/dS ratios

  • Identify potential regulatory elements using comparative sequence analysis of upstream regions

In vitro reconstitution systems for functional analysis of SecG in protein translocation

To assess the functional role of SecG in protein translocation:

  • Purify individual components of the Sec machinery (SecY, SecE, SecG, SecA)

  • Reconstitute the SecYEG complex in proteoliposomes

  • Prepare fluorescently labeled pre-proteins as translocation substrates

  • Measure translocation efficiency using protease protection assays

  • Compare wild-type SecYEG activity with complexes containing mutated SecG

  • Analyze the energy requirements for translocation using ATP analogs

  • Investigate the interaction with other components like YidC using co-reconstitution approaches

Conservation patterns of secG across different Buchnera strains

The conservation status of secG across different Buchnera strains provides insights into its evolutionary importance in this endosymbiont:

Buchnera StrainsecG StatusGenome Size (Mb)Host Aphid Species
BAp (B. aphidicola str. APS)Present0.64Acyrthosiphon pisum
BSg (B. aphidicola str. Sg)Present0.64Schizaphis graminum
BBp (B. aphidicola str. Bp)Present0.62Baizongia pistaciae
BCc (B. aphidicola str. Cc)Present0.42Cinara cedri
BCt (B. aphidicola str. Ct)Present0.42Cinara tujafilina

The consistent conservation of secG across all sequenced Buchnera strains, despite varying degrees of genome reduction, emphasizes its essential role in protein transport. This pattern contrasts with many other genes that have been lost in certain lineages, as shown in the comparative gene loss analysis .

Relationship between SecG function and genome reduction in obligate endosymbionts

The retention of secG in the highly reduced genome of Buchnera aphidicola suggests that protein translocation remains a critical function even as many other cellular processes have been lost or simplified. To understand this relationship:

  • Compare the SecG amino acid sequence conservation relative to other retained proteins

  • Analyze whether secG has undergone accelerated evolution compared to the same gene in free-living relatives

  • Investigate potential co-evolution between secG and other components of the Sec machinery

  • Examine if changes in secG correlate with specific host adaptations or genome reduction events

Impact of plasmid-encoded elements on SecG function in Buchnera strains

Some Buchnera strains contain plasmids that carry essential genes, potentially influencing protein transport systems:

  • The 3.0-kb plasmid (pBTc2) in Buchnera from Tetraneura caerulescens carries trpEG genes

  • The plasmid pBPs2 from Pemphigus spyrothecae has a different replicon containing iteron sequences and repAC

  • These plasmid-encoded elements may interact with the SecYEG machinery for their own protein products

  • Research should investigate whether plasmid-encoded regulatory elements influence secG expression

  • Potential research could explore if plasmid-encoded factors enhance or modify SecG function in protein translocation

Protein transport assays specific for Buchnera SecG research

To assess the functional capacity of Buchnera SecG in protein transport:

  • Develop in vitro translocation assays using purified components and fluorescently labeled substrates

  • Perform complementation studies in SecG-deficient E. coli strains

  • Use site-directed mutagenesis to identify critical residues for SecG function

  • Implement protease protection assays to measure translocation efficiency across membranes

  • Employ real-time fluorescence techniques to monitor protein movement through the translocon

  • Analyze ATP hydrolysis rates to determine energy requirements for SecG-dependent transport

  • Develop specialized reporter systems for protein translocation in vivo

Structural analysis approaches for Buchnera SecG

To characterize the structural features of Buchnera SecG:

  • Apply X-ray crystallography or cryo-electron microscopy for high-resolution structure determination

  • Use nuclear magnetic resonance (NMR) for structural analysis of specific domains

  • Implement molecular dynamics simulations to predict conformational changes during protein transport

  • Apply hydrogen-deuterium exchange mass spectrometry to identify flexible regions

  • Use crosslinking studies to determine proximity relationships within the SecYEG complex

  • Analyze lipid-protein interactions using specialized mass spectrometry techniques

  • Compare structural features with SecG proteins from free-living bacteria to identify adaptations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.