Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Protein HflK (hflK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hflK; BU568; Protein HflK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
hflK
Target Protein Sequence
MVWNKPNNNKPDFDPWGNKDSKSKNCSDNKHEKKTTVLDIKNFLYNLKNIITKKTDSSNS SKKITYPFSIIIFISFFIWGVSGFYTITEAERGVVTSFGKFSHLVQPGLNWRPVFFNEVK PVNVETVRELATSGIMLTADENVVRVEMNVQYKITNPADYLFSVCYPDDSLRQATDSALR GVIGHSTMDRVLTEGRTLVRSDTQKEIENTIKPYKMGITILDVNFQTARPPEEVKAAFDD AIAARENREQYVREAEAYSNEVKPKANGKAQRILEEAKSYSSRIILQAQGEVARFSKILP EYRIAKKITLKRLYIESMERLLRKNKKIFIDTNNNPMFFFSLDNFFSKIKIPNKNFKDHI KINKNHSPFNKKVKNTNYFPFLSPDNISEQRRINSIRSDLKKIGRE
Uniprot No.

Target Background

Function
HflC and HflK may encode or regulate a protease.
Database Links

KEGG: buc:BU568

STRING: 107806.BU568

Protein Families
Band 7/mec-2 family, HflK subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the biological function of HflK protein in Buchnera aphidicola?

HflK is part of the SPFH complex HflK-HflC that plays a crucial role in regulating aerobic respiration in bacteria. Research has demonstrated that this complex significantly affects bacterial growth under high aeration conditions. In E. coli studies, deletion of the hflK and hflC genes resulted in growth defects that were dependent on aeration and medium composition, with more pronounced effects at higher shaking rates (increased aeration) . The HflKC complex appears to regulate the abundance of respiration-related proteins, particularly affecting cytochrome quinol oxidases that are used under different oxygen conditions .

What is the relationship between Buchnera aphidicola and its aphid host?

Buchnera aphidicola is an obligate endosymbiont that has established an essential mutualistic relationship with aphids over 80-150 million years of co-evolution . The transmission of Buchnera is strictly maternal, resulting in perfect congruence between bacterial and host phylogenies . This symbiont is crucial for aphid survival and reproduction - experimental removal of Buchnera results in severely stunted growth and reproductive failure in the host . Buchnera synthesizes essential amino acids and other nutrients absent in the aphid's phloem diet, making it indispensable for host nutrition .

What are the optimal storage conditions for recombinant HflK protein?

The recombinant HflK protein should be stored at -20°C or -80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles which can degrade protein quality . Working aliquots can be stored at 4°C for up to one week. The protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For reconstitution, it is recommended to centrifuge the vial briefly before opening and then reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% (with 50% being standard) is recommended for long-term storage .

How can researchers quantify Buchnera populations in experimental systems?

Quantitative PCR (qPCR) techniques are the established method for quantifying Buchnera populations in experimental systems . This approach typically involves:

  • Primer design targeting Buchnera-specific genes (such as the dnaK gene)

  • Using host genes (such as ef1α from the aphid) as controls for normalization

  • Establishing standard curves with known quantities of target DNA

When analyzing data, researchers typically express Buchnera titers relative to the host to account for variation in sample size and extraction efficiency . The density of bacteriocytes (specialized cells housing the symbionts) can also serve as a proxy measurement for Buchnera population size. PCR diagnosis confirming the presence of Buchnera in bacteriocytes is recommended as a verification step .

What expression systems are most effective for producing recombinant HflK protein?

E. coli expression systems are most commonly used for producing recombinant HflK protein from Buchnera aphidicola . The protein can be successfully expressed as a full-length construct (amino acids 1-406) with an N-terminal His tag to facilitate purification. When expressing this protein, researchers should optimize:

  • Induction conditions (temperature, IPTG concentration, and duration)

  • Lysis methods to effectively release the protein while maintaining its native structure

  • Purification protocols using nickel affinity chromatography leveraging the His tag

Post-purification quality assessment is crucial, with SDS-PAGE analysis recommended to confirm protein purity (should exceed 90%) . Additionally, functional assays should be performed to verify that the recombinant protein maintains its biological activity.

How does the genetic variation in HflK across different Buchnera strains correlate with host adaptation?

Genetic analysis of different Buchnera strains reveals significant evolutionary patterns in the HflK gene that may reflect adaptation to different aphid hosts. The three complete genomes of different Buchnera subspecies from the gall-forming aphid Baizongia pistaciae (Bp), the greenbug aphid Schizaphis graminum (Sg), and the pea aphid Acyrthosiphon pisum (Ap) show remarkable synteny and gene content conservation despite their evolutionary divergence .

Comparative analysis of nucleotide substitution patterns in HflK across these strains shows evidence of strand-specific mutation biases, with different substitution rates between leading and lagging strands . These patterns may reflect adaptations to the specific metabolic requirements of different aphid hosts. Researchers investigating this correlation should employ:

  • Relative rate tests using appropriate outgroups (such as Wigglesworthia glossinidia or Blochmannia floridanus)

  • Analysis focused on nonsynonymous substitutions (as synonymous sites are often saturated)

  • Statistical corrections for multiple tests (such as Bonferroni-Holm) when analyzing substitution patterns

What environmental factors influence HflK expression and function in the Buchnera-aphid symbiosis?

Environmental factors significantly influence the Buchnera symbiont population dynamics, which likely affects HflK expression and function. Host plant species has been demonstrated to significantly impact Buchnera titers in aphids, with secondary metabolites playing a crucial role in this regulation . Specifically:

Host Plant FactorEffect on Buchnera Population
Gossypol (cotton metabolite)Suppresses Buchnera populations
Cucurbitacin (cucurbit metabolite)Increases Buchnera densities
Host transfer (to novel plant)Population fluctuations for 2 generations before stabilizing

Additionally, temperature represents another critical environmental factor. Heat stress reduces Buchnera titers, with variation in the promoter of a Buchnera heat shock gene impacting aphid thermal tolerance . Oxygen availability also affects HflK function, as seen in experiments with the HflKC complex in E. coli where growth phenotypes were highly dependent on aeration conditions .

How does the HflK-HflC complex regulate respiratory protein expression in bacterial systems?

Proteomic analysis has revealed that the HflK-HflC complex regulates the abundance of respiration-related proteins in a highly specific manner. In E. coli, deletion of the hflK and hflC genes resulted in marked changes in the abundance of cytochrome quinol oxidases under aerobic conditions . The data showed:

  • Reduced levels of CyoAB (catalytic subunits of the aerobic quinol oxidase bo₃) in ΔhflKC strains

  • Increased levels of CydAB (microaerobic quinol oxidase) in ΔhflKC strains

  • More extensive changes in protein expression when grown in tryptone broth (TB) compared to Luria-Bertani (LB) medium

These findings suggest that the HflK-HflC complex functions as a regulatory system that helps bacteria adapt to different oxygen conditions by modulating the expression of appropriate respiratory chain components . This regulation appears to be responsive to both oxygen availability and nutritional status, with more pronounced effects observed under specific medium compositions.

What are common challenges in purifying recombinant HflK protein and how can they be addressed?

Researchers frequently encounter several challenges when purifying recombinant HflK protein:

  • Protein solubility issues: HflK may form inclusion bodies during expression. This can be addressed by:

    • Optimizing induction conditions (lower temperature, reduced IPTG concentration)

    • Using solubility-enhancing fusion tags (beyond the His tag)

    • Employing specialized E. coli strains designed for membrane or difficult proteins

  • Purification yield variability: To improve consistency:

    • Strictly control culture densities before induction

    • Optimize lysis conditions to ensure complete cell disruption

    • Consider on-column refolding protocols if protein is recovered from inclusion bodies

  • Protein activity loss: To maintain functional integrity:

    • Add protease inhibitors during purification

    • Include stabilizing agents (such as the 6% trehalose in storage buffer)

    • Avoid repeated freeze-thaw cycles by creating single-use aliquots

How can researchers differentiate between the effects of HflK versus HflC in experimental systems?

Differentiating between the effects of HflK and HflC requires careful experimental design:

  • Gene deletion approaches: Create single and double deletion mutants (ΔhflK, ΔhflC, and ΔhflKC) to compare phenotypes. Research has shown that while ΔhflKC and ΔhflK strains exhibit growth defects under high aeration conditions, the ΔhflC strain showed growth patterns similar to wild-type, suggesting distinct roles .

  • Complementation experiments: Introduce plasmids expressing either hflK alone, hflC alone, or both genes together into deletion strains. This allows assessment of whether individual proteins can rescue specific phenotypes or whether both are required .

  • Proteomic analysis: Compare protein expression profiles between different mutant strains under various growth conditions. This approach has revealed that the absence of HflKC affects the abundance of respiration-related proteins, particularly cytochrome quinol oxidases .

A comprehensive analysis should include multiple growth conditions, as the effects of these genes appear to be highly dependent on environmental factors such as aeration levels and medium composition .

What considerations are important when analyzing evolutionary patterns in HflK across different Buchnera strains?

When analyzing evolutionary patterns in HflK across different Buchnera strains, researchers should consider:

  • Genomic context: Despite their small genomes (<700 kb), Buchnera strains show almost perfect gene order synteny and gene content conservation . The genomic location of hflK (leading versus lagging strand) can influence mutation patterns and should be accounted for in analyses.

  • Appropriate outgroup selection: For relative rate tests, selecting appropriate outgroups is crucial. Wigglesworthia glossinidia and Blochmannia floridanus represent outgroups with weak versus strong DNA strand asymmetry, respectively, and both are close relatives to Buchnera with similar genomic GC contents .

  • Substitution pattern analysis: When examining evolutionary changes:

    • Focus on nonsynonymous substitutions as synonymous sites are often saturated between species

    • Analyze different codon positions separately

    • Apply appropriate statistical corrections (e.g., Bonferroni-Holm) for multiple tests

  • Host-symbiont co-evolution: Consider that Buchnera evolution is tightly linked to host evolution due to strict maternal transmission, resulting in congruent phylogenies .

What are promising approaches for studying HflK-mediated regulation of bacterial respiration in non-model organisms?

Future research on HflK-mediated regulation of bacterial respiration in non-model organisms could benefit from:

  • Comparative genomics: Analyzing the presence, absence, and sequence variation of hflK across diverse bacterial lineages to identify evolutionary patterns and predict functional importance in different ecological niches.

  • Heterologous expression systems: Expressing HflK proteins from non-model organisms in tractable systems (such as E. coli) and assessing their ability to complement mutant phenotypes. This approach could reveal conserved versus divergent functions.

  • Targeted gene editing: Employing CRISPR-Cas systems modified for use in non-model bacteria to create precise mutations in hflK and assess the resulting phenotypes under various environmental conditions.

  • Metabolomic profiling: Comparing metabolite profiles between wild-type and hflK mutant strains to identify specific metabolic pathways affected by HflK function across different bacterial species.

These approaches would help determine whether the respiratory regulation function observed in model systems extends to other bacterial lineages, including obligate symbionts like Buchnera aphidicola.

How might HflK function be leveraged to manipulate Buchnera-aphid symbiosis for agricultural applications?

Understanding HflK function could provide novel approaches for manipulating the Buchnera-aphid symbiosis in agricultural contexts:

  • Symbiont population control: Since HflK affects respiratory function, targeting this protein could potentially regulate Buchnera population size, indirectly affecting aphid fitness. This could form the basis for novel pest management strategies.

  • Host plant resistance enhancement: Research shows that host plant secondary metabolites like gossypol suppress Buchnera populations . Breeding programs could select for plant varieties with optimal levels of compounds that affect HflK function or expression.

  • Predictive models for aphid adaptation: Knowledge of how environmental factors influence HflK function could help predict aphid population dynamics in changing agricultural landscapes or under climate change scenarios.

  • Symbiont engineering approaches: While technically challenging due to the obligate nature of Buchnera, understanding HflK regulation networks could eventually allow for symbiont modification to reduce aphid fitness on crops.

Any application would require thorough ecological risk assessment, as manipulating fundamental symbiotic relationships could have unexpected consequences in agricultural ecosystems.

What research gaps remain in our understanding of HflK structure-function relationships?

Several significant knowledge gaps remain in our understanding of HflK structure-function relationships:

  • High-resolution structural data: While the amino acid sequence of HflK is known , high-resolution structural information (crystal structure or cryo-EM) is lacking. Such data would provide insights into functional domains and potential interaction surfaces.

  • Protein-protein interaction networks: Comprehensive identification of HflK interaction partners beyond HflC would help elucidate its full functional roles. Techniques such as BioID, proximity labeling, or co-immunoprecipitation coupled with mass spectrometry could address this gap.

  • Post-translational modifications: Investigation of potential post-translational modifications that might regulate HflK function under different environmental conditions represents an unexplored area.

  • Functional evolution in endosymbionts: Comparative functional studies between HflK from free-living bacteria versus obligate endosymbionts like Buchnera could reveal adaptations specific to the symbiotic lifestyle.

  • Regulatory mechanisms: The upstream regulators that control hflK expression in response to environmental cues remain poorly characterized, particularly in the context of the Buchnera-aphid symbiosis.

Addressing these research gaps would significantly advance our understanding of how this protein contributes to bacterial physiology and symbiotic relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.