Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Ubiquinol oxidase subunit 2 (cyoA)

Shipped with Ice Packs
In Stock

Description

Introduction to Buchnera aphidicola and its Symbiotic Role

Buchnera aphidicola is a bacterium that exists as a primary endosymbiont within aphids . Specifically, it has been studied in the pea aphid, Acyrthosiphon pisum . This symbiotic relationship, which began between 160 to 280 million years ago, is characterized by the bacteria's presence in specialized cells called bacteriocytes within the aphid's body . These bacteriocytes, numbering between sixty and eighty, reside in a structure called the bacteriome . A single aphid can host approximately 5.6 x 10^6 Buchnera cells .

The aphid and Buchnera engage in a mutually beneficial relationship, where Buchnera provides essential nutrients such as amino acids, vitamins, and sterols that the aphid cannot synthesize on its own and are deficient in its phloem sap diet . In return, the aphid supplies Buchnera with nutrients like nonessential amino acids and carbohydrates . This partnership is crucial for the aphid's development, growth, and reproduction .

Genomic and Metabolic Features of Buchnera aphidicola

As an obligate intracellular symbiont, Buchnera aphidicola has undergone significant genomic and biochemical changes . The bacterium has a small, genetically stable genome due to its long-term association with aphids and vertical transmission through maternal lineages . Buchnera lacks the genes required for synthesizing lipopolysaccharides, amino sugars, fatty acids, phospholipids, and complex carbohydrates . Despite these reductions, Buchnera overproduces tryptophan and other amino acids due to a loss of regulatory factors .

Ubiquinol Oxidase and the Role of CyoA

Ubiquinol oxidase is an enzyme complex involved in the respiratory chain of Buchnera aphidicola, specifically the cytochrome o ubiquinol oxidase . This enzyme complex facilitates the transfer of electrons from ubiquinol to oxygen, generating water and contributing to the proton gradient that drives ATP synthesis. The ubiquinol oxidase complex consists of several subunits, including CyoA, CyoB, CyoC, and CyoD.

CyoA (Ubiquinol oxidase subunit 2) is one of the key subunits of the cytochrome o ubiquinol oxidase complex . It is involved in the electron transfer process within the respiratory chain. Genes for proteins such as CyoA are present in Buchnera aphidicola .

Recombinant CyoA: Production and Characteristics

Recombinant CyoA is produced using genetic engineering techniques, where the gene encoding CyoA from Buchnera aphidicola subsp. Acyrthosiphon pisum is expressed in a heterologous host organism, such as E. coli . The recombinant protein can then be purified and used for various biochemical and structural studies. Recombinant proteins like CyoA are often tagged with histidine (His-tagged) to facilitate purification using affinity chromatography .

Table 1: Characteristics of Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum CyoA

CharacteristicDescription
Gene NamecyoA
Other NamesCytochrome O ubiquinol oxidase subunit II
Source OrganismBuchnera aphidicola subsp. Acyrthosiphon pisum
Host for ExpressionE. coli (in vitro expression system)
Purity≥ 85% as determined by SDS-PAGE
Molecular WeightVaries depending on the presence of tags (e.g., His-tag)
FunctionComponent of the cytochrome o ubiquinol oxidase complex, involved in electron transport during respiration
ApplicationsBiochemical studies, structural analysis, antibody production
Available from SuppliersMyBioSource.com, CUSABIO

Research Applications and Significance

Recombinant CyoA and other subunits of the ubiquinol oxidase complex are valuable tools for studying the respiratory chain of Buchnera aphidicola and its role in the symbiotic relationship with aphids. These proteins can be used to:

  1. Study enzyme kinetics and mechanisms: Understanding how CyoA and the ubiquinol oxidase complex function in electron transport and ATP generation.

  2. Investigate protein-protein interactions: Determining how CyoA interacts with other subunits of the complex and other proteins in Buchnera aphidicola.

  3. Develop inhibitors: Identifying compounds that can inhibit the activity of ubiquinol oxidase, potentially disrupting the symbiosis and providing a novel approach for aphid control.

  4. Structural studies: Determining the three-dimensional structure of CyoA and the ubiquinol oxidase complex to gain insights into their function.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cyoA; BU472; Cytochrome bo(3 ubiquinol oxidase subunit 2; Cytochrome o ubiquinol oxidase subunit 2; Cytochrome o subunit 2; Oxidase bo(3 subunit 2; Ubiquinol oxidase polypeptide II; Ubiquinol oxidase subunit 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-296
Protein Length
Full Length of Mature Protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
cyoA
Target Protein Sequence
CNNPLLNSHGTIATEEYSLILISFIMMLFIIIPVIFMTIYFSLKYRSTNVNQIYKPNWCD SKKIEIVVWTIPIIIVSFLAFLSWSYTHKLDPKKSIVSLNNPIKIDAVALDWKWLFIYPD YNIATINEIMFPVNRPIVFRITSNSVMNAFFIPSLGSQIYAMPGMTTKLNLIANDVGKYK GISSNYSGHGFSNMKFTAISVLKNSTFLDWVKKVQASSIKLNTMKTFDIISIPNENYSIE YFSSVKKNLFNKIKNQYSIKHFILDENLSHEIVKKNFNMEK
Uniprot No.

Target Background

Function

Cytochrome bo(3) ubiquinol terminal oxidase is a key component of the aerobic respiratory chain in E. coli, predominating under high-aeration growth conditions. Besides electron transfer, it exhibits proton pump activity across the membrane, translocating 2 protons per electron.

Database Links

KEGG: buc:BU472

STRING: 107806.BU472

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.