Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Uncharacterized MscS family protein BU452 (BU452)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
BU452; Uncharacterized MscS family protein BU452
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
BU452
Target Protein Sequence
MLFIKIEIIAKTLLIINKKYTEIKMDELNVVNNINHAGTWLIRNQELLLRYTINLTSAII ILVVGMFISKIISNGANQVLITRNIDATIAGFLSALMRYIIITFTFIAALGRIGVQTTSV IAILGAAGMAIGLALQGSLSNFAAGVLLVTLRPLKTEEYVDLGSVSGTVLNIHIFYTTLR TLDGKIVVVPNNKIISGNIINYSREPARRNEFIISVSYNSDIDLVIKILRSVIEKEERVI KDKDIIVGLSELAPSSLNFIVRCWSKNHDLNTVYWDLMAKFKKELDKNNINIPFPQLDVH VYKKK
Uniprot No.

Target Background

Database Links

KEGG: buc:BU452

STRING: 107806.BU452

Protein Families
MscS (TC 1.A.23) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is BU452 and what is its genomic context in Buchnera aphidicola?

BU452 (referred to as yggB in some literature) is an uncharacterized MscS family protein from Buchnera aphidicola, the obligate intracellular bacterial symbiont of aphids. It is classified as a mechanosensitive ion channel homolog. In the Buchnera aphidicola genome from the Acyrthosiphon pisum strain (APS), BU452 is located in a genomic region containing genes involved in central metabolism. Specifically, it is positioned between fba (fructose-bisphosphate aldolase) and recC (exodeoxyribonuclease V 125 kD polypeptide) .

The gene is encoded in nucleotide sequence 493043-493960 on the + chain of the Buchnera genome . Unlike many genes in the highly reduced Buchnera genome, BU452 has been retained across various Buchnera strains from different aphid species, suggesting functional importance in the symbiotic relationship .

How does the BU452 protein compare structurally to other MscS family proteins?

BU452 belongs to the MscS (Mechanosensitive channel, small) family of proteins, which sense elevated membrane tension that arises during osmotic shock . The protein is predicted to have 3 transmembrane segments (TM), consistent with the core structural organization of MscS family proteins . This contrasts with larger MscS homologs like YbiO and YjeP that can have up to 11 transmembrane segments .

The following table compares key structural features of BU452 with other MscS family proteins:

ProteinTransmembrane SegmentsQuaternary StructureSize (approx.)Special Features
BU452 (YggB)3 (i)*Homo-heptamer305 amino acidsConserved in reduced genome
MscS (E. coli)3Homo-heptamer286 amino acidsWell-characterized channel
YbiO11Unknown>700 amino acidsExtensive periplasmic domains
YjeP11Unknown>700 amino acidsExtensive periplasmic domains
YnaI5Unknown~350 amino acidsSmaller topological class

*i = integral membrane protein

Notably, sequence analysis reveals that the third transmembrane segment (TMS) of MscS family proteins exhibits a 20-residue motif that is shared with the channel-forming TMS of MscL proteins, suggesting this conserved TMS serves as the channel-forming helix in a homooligomeric structure .

What expression systems are typically used for producing recombinant BU452 protein?

Because Buchnera aphidicola is an uncultivable obligate endosymbiont, recombinant production of its proteins requires heterologous expression systems. The most common approach for expressing BU452 is using Escherichia coli expression systems.

Typical expression parameters include:

  • Host strain: E. coli BL21(DE3) or similar expression-optimized strains

  • Expression vector: pET-based vectors with T7 promoter

  • Induction: IPTG (isopropyl β-D-1-thiogalactopyranoside)

  • Tags: His-tag or GST-tag for purification

  • Storage buffer: Tris-based buffer with 50% glycerol at -20°C

The purification typically involves affinity chromatography followed by size exclusion chromatography to maintain the native oligomeric state. Since BU452 is a membrane protein, detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are commonly used during extraction and purification to maintain protein stability and function.

How has the function of BU452 evolved in the context of Buchnera's genome reduction?

Buchnera aphidicola has undergone severe genome reduction during its evolution as an obligate endosymbiont, with a genome size of approximately 640 kb compared to 4.6 Mb in free-living bacteria like Escherichia coli. Despite this reduction, Buchnera has retained BU452 (yggB) across different strains associated with various aphid hosts , suggesting that this protein serves an essential function in the symbiotic relationship.

The conservation of BU452 is particularly significant because Buchnera has lost most transcriptional regulatory elements through reductive evolution . This suggests that BU452 may be constitutively expressed or regulated through alternative mechanisms that do not rely on conventional transcription factors.

Comparative analysis of Buchnera strains from different aphid hosts shows that BU452 is present in:

  • Buchnera from Acyrthosiphon pisum (BU452/YggB)

  • Buchnera from Schizaphis graminum (BUSg_437/YggB)

  • Buchnera from Baizongia pistaciae (BBp_402/YggB)

  • Buchnera from Cinara cedri (BCc_280/YggB)

This conservation across phylogenetically diverse Buchnera strains with different genomic reduction patterns emphasizes the importance of this mechanosensitive channel in maintaining cellular homeostasis, potentially during transport between host and symbiont compartments .

What experimental approaches are most effective for characterizing the function of BU452?

Characterizing the function of BU452 requires a multi-faceted approach combining electrophysiology, molecular biology, and biophysical techniques:

  • Patch Clamp Analysis:

    • Giant spheroplast preparation from E. coli expressing recombinant BU452

    • Measurement of channel activity under controlled pressure gradients

    • Characterization of ion selectivity, conductance, and gating properties

  • Liposome Reconstitution Assays:

    • Purification of BU452 and incorporation into liposomes

    • Fluorescent dye efflux assays to measure channel activity in response to osmotic shock

    • Stopped-flow measurements to determine activation threshold and kinetics

  • In vivo Functional Complementation:

    • Expression of BU452 in E. coli strains lacking endogenous mechanosensitive channels

    • Hypoosmotic shock survival assays

    • Assessment of solute release during osmotic downshock

  • Structural Studies:

    • Cryo-electron microscopy to determine quaternary structure

    • Site-directed mutagenesis of conserved residues

    • Molecular dynamics simulations to model channel gating

A particularly effective approach is to utilize the MJF641 E. coli strain (Δ7), which lacks mscL and all six members of the mscS family, as a background for functional complementation studies . This allows for the assessment of BU452 function without interference from endogenous mechanosensitive channels.

What role might BU452 play in the symbiotic relationship between Buchnera and aphids?

BU452 (YggB) likely plays a critical role in maintaining osmotic homeostasis within the bacteriocyte, the specialized aphid cell housing Buchnera. The symbiotic relationship centers around nutrient exchange, particularly the provision of essential amino acids (EAAs) to the aphid host .

Several lines of evidence suggest potential functions for BU452 in symbiosis:

  • Nutrient Exchange Regulation:

    • BU452 may facilitate the controlled release of amino acids and other metabolites from Buchnera to the host cytoplasm

    • Channel activity could be regulated by changes in membrane tension resulting from metabolic activity

  • Osmotic Protection:

    • Buchnera resides within a specialized host-derived membrane called the symbiosomal membrane

    • BU452 may protect Buchnera from osmotic stress caused by fluctuations in host physiology

  • Signal Transduction:

    • Despite the loss of conventional transcriptional regulators, Buchnera shows transcriptional responses to nutritional demand from aphids

    • BU452 could serve as a tension-sensitive regulator coupling host physiological state to bacterial gene expression

Research investigating transcriptional regulation in Buchnera in response to amino acid depletion found significant transcriptional changes despite the absence of known regulatory elements . While unambiguous evidence for scaling of essential amino acid biosynthesis to aphid demand was not obtained, mechanosensitive channels like BU452 could be involved in sensing environmental changes that trigger these responses.

How do the characteristics of BU452 differ among Buchnera strains from different aphid species?

Comparative analysis reveals interesting patterns in the conservation and potential functional variation of BU452 across Buchnera strains from different aphid hosts:

Buchnera StrainAphid HostProtein IDMembrane SystemConservation of Channel PropertiesNotable Features
B. aphidicola APSAcyrthosiphon pisumYggB:BU452Three-membranedFully conservedStandard reference strain
B. aphidicola SgSchizaphis graminumYggB:BUSg_437Three-membranedFully conservedSimilar transport system to APS
B. aphidicola BpBaizongia pistaciaeYggB:BBp_402Double membranePotentially modifiedLost all outer-membrane integral proteins
B. aphidicola CcCinara cedriYggB:BCc_280Three-membranedPotentially modifiedExtremely poor repertoire of transporters

Most significantly, the Buchnera from B. pistaciae appears to possess a unique double membrane system and has accordingly lost all of its outer-membrane integral proteins . Despite this difference in membrane architecture, BU452 has been retained, suggesting its primary function may be related to the inner membrane.

The Buchnera from C. cedri has an extremely poor repertoire of transporters, with almost no ATP-driven active transport remaining, yet it has preserved BU452 . This suggests that passive transport mechanisms like mechanosensitive channels may become more crucial when active transport systems are lost during genome reduction.

What challenges exist in studying the regulation of BU452 expression in Buchnera?

Studying the regulation of BU452 expression presents several unique challenges:

  • Loss of Transcriptional Regulators:

    • Buchnera has lost most of its transcriptional regulatory elements during genome reduction

    • Standard approaches for studying gene regulation may not apply

  • Uncultivability:

    • Buchnera cannot be cultured outside its host, complicating direct experimental manipulation

    • Studies must rely on aphid-Buchnera systems or heterologous expression

  • Complex Membrane Environment:

    • BU452 functions within a multi-membrane system (host membrane, symbiosomal membrane, bacterial membrane)

    • Reconstituting this environment for functional studies is challenging

Despite these challenges, recent research has demonstrated that Buchnera shows significant transcriptional regulation at different organizational levels in its genome: between genes, within putative transcription units, and within specific metabolic pathways . Microarray experiments designed to profile gene expression in Buchnera under different conditions (such as specific depletion of tyrosine and phenylalanine in aphid diet) have provided insights into these regulatory mechanisms .

Researchers investigating this question typically employ:

  • Aphid feeding experiments with controlled diets

  • RNA-seq or microarray analysis of Buchnera transcripts

  • Budget analysis to quantify nutritional demands from aphids toward their symbiotic bacteria

  • Quantitative proteomics to correlate transcript and protein levels

How can structural biology approaches be applied to understand BU452 function?

Structural characterization of BU452 presents challenges common to membrane proteins but would provide valuable insights into its function in the Buchnera-aphid symbiosis. The following approaches are particularly relevant:

  • Homology Modeling:

    • Based on the crystal structure of E. coli MscS (solved at 3.5 Å resolution)

    • Modeling of the homopentameric channel structure

    • Identification of key residues in the channel pore

  • Cryo-Electron Microscopy:

    • Direct structural determination without crystallization

    • Visualization of different conformational states (closed, intermediate, open)

    • Analysis of protein-lipid interactions at the membrane interface

  • Site-Directed Spin Labeling (SDSL) and Electron Paramagnetic Resonance (EPR):

    • Measurement of conformational changes during channel gating

    • Mapping of water-accessible residues in the channel pore

    • Determination of distances between subunits in the oligomeric complex

  • Molecular Dynamics Simulations:

    • Modeling of membrane tension effects on channel structure

    • Simulation of ion and solute permeation

    • Investigation of gating mechanisms and energy landscapes

The MscS protein forms a homoheptameric channel that undergoes extensive rearrangement during opening . The channel's closed state depends on a tight seal formed by a ring of hydrophobic residues near the membrane face of the first transmembrane segment (TMS1) . Structural analysis of BU452 would reveal whether these features are conserved in this symbiont protein.

What are the key considerations for designing functional assays for BU452?

When designing functional assays for BU452, researchers should consider:

  • Channel Properties Assessment:

    • Electrophysiological characterization using patch clamp techniques

    • Determination of channel conductance, ion selectivity, and gating parameters

    • Pressure threshold for activation compared to E. coli MscS

  • Osmotic Shock Response:

    • Complementation assays in MJF641 E. coli strain (lacking all mechanosensitive channels)

    • Measurement of cell survival rates following hypoosmotic shock

    • Assessment of solute release during controlled osmotic downshock

  • Protein-Protein Interactions:

    • Co-immunoprecipitation to identify interaction partners

    • Bacterial two-hybrid assays

    • Crosslinking studies to capture transient interactions

  • Localization in Bacteriocytes:

    • Immunogold electron microscopy in aphid bacteriocytes

    • Fluorescence microscopy using antibodies against BU452

    • Assessment of distribution across the bacterial membrane

A particularly informative experimental design would involve expressing BU452 in E. coli strains with varying combinations of endogenous mechanosensitive channels deleted. For example, complementation in the MJF641 strain (Δ7) lacking all mechanosensitive channels would reveal if BU452 alone can protect against osmotic shock, while expression in partial deletion backgrounds would indicate potential functional interactions with other channel types .

How should researchers address potential artifacts when expressing BU452 in heterologous systems?

Expression of BU452 in heterologous systems may introduce artifacts that could complicate functional characterization:

  • Membrane Composition Differences:

    • E. coli membrane composition differs from Buchnera

    • Solution: Consider supplementing growth media with specific lipids or expressing in yeast with more flexible lipid composition

  • Protein Folding and Stability:

    • Membrane proteins often face folding challenges in heterologous systems

    • Solution: Optimize expression conditions (temperature, induction level) and consider fusion partners that enhance stability

  • Oligomerization State:

    • Native oligomeric state may not be maintained in heterologous systems

    • Solution: Use crosslinking, native PAGE, or size exclusion chromatography to verify oligomeric state

  • Interaction with Host Proteins:

    • Loss of potential interacting partners from Buchnera or aphid host

    • Solution: Consider co-expression with candidate interacting proteins

  • Post-Translational Modifications:

    • Different patterns of post-translational modifications in E. coli

    • Solution: Mass spectrometry analysis to identify differences in modifications

A carefully designed control experiment would be to express and characterize the well-studied E. coli MscS protein alongside BU452 under identical conditions, allowing direct comparison of properties and identification of potential artifacts specific to the heterologous expression system.

What techniques can be used to study BU452 in its native environment within aphid bacteriocytes?

Studying BU452 in its native environment presents unique challenges due to the uncultivable nature of Buchnera and the complex structure of aphid bacteriocytes. The following techniques offer valuable approaches:

  • Microscopy Techniques:

    • Immunogold electron microscopy using antibodies against BU452

    • Super-resolution microscopy to visualize distribution across bacterial and symbiosomal membranes

    • Serial block-face scanning electron microscopy for 3D reconstruction of bacteriocytes

  • In situ Molecular Analysis:

    • RNA-FISH (fluorescence in situ hybridization) to visualize BU452 transcript localization

    • Proximity labeling (BioID, APEX) to identify proteins near BU452 in intact bacteriocytes

    • Laser capture microdissection to isolate bacteriocytes for targeted analysis

  • Manipulating Expression in vivo:

    • RNAi feeding to knockdown BU452 expression

    • Aphid feeding experiments with controlled diets to alter metabolic demands

    • Tracking physiological responses in both aphid and Buchnera after manipulations

  • Biochemical Analysis of Isolated Bacteriocytes:

    • Gentle isolation of bacteriocytes from aphid tissues

    • Membrane fractionation to separate host and bacterial membranes

    • Proteomic analysis of isolated membrane fractions

Comparative membrane topology analysis of symbiosomal vesicles from different aphid species can provide insights into how BU452 functions within different membrane architectures . This is particularly valuable given the differences observed between the three-membraned systems in A. pisum and S. graminum versus the unique double membrane system in B. pistaciae .

How does BU452 compare to mechanosensitive channels in other insect endosymbionts?

Comparative analysis of BU452 with mechanosensitive channels in other insect endosymbionts provides insights into evolutionary conservation and specialization:

EndosymbiontInsect HostMscS HomologGenome SizeSpecial Features
Buchnera aphidicola (APS)Acyrthosiphon pisumYggB (BU452)640 kbThree-membrane system
Buchnera (Sg)Schizaphis graminumYggB (BUSg_437)630 kbSimilar to APS strain
Buchnera (Cc)Cinara cedriYggB (BCc_280)416 kbExtremely reduced transport systems
WigglesworthiaTsetse flyYggB homolog700 kbDifferent host relationship
BlochmanniaCarpenter antsYggB homolog705-809 kbNutritional mutualist
SodalisVarious insectsMultiple MscS homologs4.2 MbRecently evolved symbiont

The most striking observation is that Buchnera has retained BU452 despite extensive genome reduction, while some other insect endosymbionts have lost this gene. This retention suggests that osmotic regulation through mechanosensitive channels is particularly important in the Buchnera-aphid symbiosis.

Notably, in the case of Geopemphigus aphids, Buchnera has been lost entirely and replaced by a symbiont from the Bacteroidetes phylum . This evolutionary replacement provides a unique opportunity to study whether the replacement symbiont has retained or evolved mechanosensitive channels to fulfill similar functions.

What insights can comparative genomics provide about the selection pressures on BU452?

Comparative genomic analysis of BU452 across different Buchnera strains reveals several key insights into selection pressures:

What can we learn about BU452 from the loss of Buchnera in some aphid lineages?

The evolutionary replacement of Buchnera with alternative symbionts in some aphid lineages provides a unique natural experiment for understanding the essential functions of Buchnera genes, including BU452:

  • Case Study: Geopemphigus Aphids:

    • Geopemphigus species have lost Buchnera and instead contain a maternally transmitted symbiont from the Bacteroidetes phylum

    • The Bacteroidetes symbiont has an intermediate genome size between free-living and symbiotic bacteria

  • Functional Replacement Analysis:

    • The Bacteroidetes symbiont retains biosynthetic pathways for amino acids and vitamins similar to Buchnera

    • Comparative analysis would reveal whether mechanosensitive channel genes similar to BU452 are present in the replacement symbiont

  • Host Adaptation Mechanisms:

    • Analysis of aphid host genes in Geopemphigus species shows changes in genes involved in symbiont interaction

    • This suggests coevolution between host and symbiont cellular machinery

  • Transport Function Evolution:

    • Different selection pressures have shaped transport functions in different aphid lineages

    • The presence or absence of genes similar to BU452 in replacement symbionts would indicate whether mechanosensitive channels are universally required for symbiosis

Research has shown that the detection of the Bacteroidetes symbiont in multiple Geopemphigus species suggests acquisition prior to the diversification of this aphid group . Comparative genomic and functional analysis of this replacement symbiont could reveal whether mechanosensitive channels similar to BU452 have been independently evolved or acquired to maintain essential functions previously performed by Buchnera.

What emerging technologies could advance our understanding of BU452 function?

Several cutting-edge technologies offer promising approaches for deeper characterization of BU452:

  • Cryo-Electron Tomography:

    • Direct visualization of BU452 in its native membrane environment within bacteriocytes

    • 3D reconstruction of channel structure and distribution without artificial expression

    • Visualization of interactions with host-derived membranes

  • Single-Molecule Force Spectroscopy:

    • Direct measurement of forces required to gate individual BU452 channels

    • Characterization of energy landscapes for channel opening and closing

    • Comparison with well-characterized MscS proteins

  • Optogenetic Control of Channel Function:

    • Engineering light-sensitive domains into BU452

    • Controlling channel activity with light in living systems

    • Directly testing the consequences of channel activation/inactivation

  • In situ Cryo-Electron Microscopy:

    • Studying BU452 structure directly within isolated bacteriocytes

    • Preserving native interactions with host membranes and other proteins

    • Revealing structural adaptations specific to the symbiotic context

  • Nanobody-Based Probes:

    • Development of specific nanobodies against BU452

    • Use as tools for localization, pull-down, and functional modulation

    • Potential for in vivo tracking of channel dynamics

These technologies could overcome many of the limitations of current approaches, particularly the challenges of studying an uncultivable symbiont and membrane protein in its native context.

How might resolving the structure and function of BU452 contribute to understanding symbiotic relationships?

Elucidating the structure and function of BU452 would provide significant insights into symbiotic relationships:

  • Molecular Basis of Nutrient Exchange:

    • Understanding how metabolites traverse multiple membrane systems

    • Revealing mechanisms for regulating nutrient flow between host and symbiont

    • Identifying potential signaling pathways coordinating metabolic activities

  • Evolutionary Mechanisms in Obligate Symbiosis:

    • Clarifying how gene retention decisions occur during genome reduction

    • Revealing functional adaptations of conserved proteins to symbiotic contexts

    • Understanding coevolution of membrane systems between host and symbiont

  • Host-Symbiont Communication:

    • Determining if mechanosensitive channels serve as sensors of host physiological state

    • Uncovering how symbionts respond to changing host nutritional demands

    • Identifying molecular dialogues that maintain the symbiotic relationship

  • Principles of Organelle Evolution:

    • Comparing symbiont membrane proteins to those in organelles (mitochondria, chloroplasts)

    • Identifying common principles in the evolution of endosymbiotic relationships

    • Understanding transitions from symbionts to organelles

  • Applications to Synthetic Biology:

    • Designing artificial symbiotic systems with controlled nutrient exchange

    • Engineering membrane transport systems for specific applications

    • Creating minimal synthetic cells with defined membrane properties

Research into transcriptional regulation in Buchnera has already shown that despite the absence of known regulatory elements, significant transcriptional regulation occurs at different levels of organization . Understanding the role of BU452 in this context could reveal novel mechanisms of gene regulation in reduced genomes.

What interdisciplinary approaches might yield new insights into BU452 function?

The complex nature of BU452 function in the Buchnera-aphid symbiosis calls for interdisciplinary approaches:

These interdisciplinary approaches could reveal how the molecular properties of BU452 translate to higher-level functions in the symbiotic relationship and ecological success of aphids.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.