Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum UPF0259 membrane protein BU276 (BU276)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum UPF0259 Membrane Protein BU276 (BU276)

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum UPF0259 membrane protein BU276 (BU276) is a recombinant protein derived from the bacterium Buchnera aphidicola, which is an obligate symbiont of the pea aphid Acyrthosiphon pisum. This symbiosis is one of the most studied insect-bacteria relationships, where Buchnera provides essential nutrients, such as amino acids, to the aphid, which are lacking in its diet of plant phloem sap .

Characteristics of Recombinant BU276 Protein

The recombinant BU276 protein is expressed in E. coli and is a full-length protein consisting of 247 amino acids. It is fused with an N-terminal His tag for easy purification and identification . The protein is available in a lyophilized form and has a purity of greater than 90% as determined by SDS-PAGE .

Amino Acid Sequence of BU276

The amino acid sequence of the BU276 protein is crucial for understanding its structure and potential functions. The sequence is as follows:

MPITVNKLRHDTHHFFYKKIGAIFFISIFATFMNILIDMFIKPDMHIVSIMENNKFINTS SLLEFIQNMNLNEKHELLKYSILKIMESLISKTTLLGSIIILISVVSEPKKKSIVSSIRT FFLFFPSLFILNFLTTFIIQIGFMLLIIPGILLSIILSLSPIILFFKKNRLLDSIRLSMY ISWKYIKIIGPGVLFWMCGKFILTMLLAHFSLINKNVLFLISNISMNILFSILIIYLFRF YMIFLRS\text{MPITVNKLRHDTHHFFYKKIGAIFFISIFATFMNILIDMFIKPDMHIVSIMENNKFINTS SLLEFIQNMNLNEKHELLKYSILKIMESLISKTTLLGSIIILISVVSEPKKKSIVSSIRT FFLFFPSLFILNFLTTFIIQIGFMLLIIPGILLSIILSLSPIILFFKKNRLLDSIRLSMY ISWKYIKIIGPGVLFWMCGKFILTMLLAHFSLINKNVLFLISNISMNILFSILIIYLFRF YMIFLRS}

This sequence provides insights into the protein's potential membrane-spanning regions and functional motifs.

Potential Applications:

  • Biotechnology: Understanding the functions of membrane proteins like BU276 could lead to novel biotechnological applications, such as improving nutrient uptake in agricultural pests or developing new strategies for pest management.

  • Symbiotic Studies: Further research on BU276 and similar proteins could enhance our understanding of symbiotic relationships, potentially revealing new mechanisms for nutrient exchange and metabolic complementarity.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please contact us in advance for arrangement and associated fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
BU276; UPF0259 membrane protein BU276
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Target Names
BU276
Target Protein Sequence
MPITVNKLRHDTHHFFYKKIGAIFFISIFATFMNILIDMFIKPDMHIVSIMENNKFINTS SLLEFIQNMNLNEKHELLKYSILKIMESLISKTTLLGSIIILISVVSEPKKKSIVSSIRT FFLFFPSLFILNFLTTFIIQIGFMLLIIPGILLSIILSLSPIILFFKKNRLLDSIRLSMY ISWKYIKIIGPGVLFWMCGKFILTMLLAHFSLINKNVLFLISNISMNILFSILIIYLFRF YMIFLRS
Uniprot No.

Target Background

Database Links

KEGG: buc:BU276

STRING: 107806.BU276

Protein Families
UPF0259 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant BU276 production?

The most commonly utilized expression system for BU276 is Escherichia coli, which provides several advantages for membrane protein production. The methodology involves:

  • Cloning the BU276 gene into an expression vector containing an N-terminal His-tag

  • Transforming the construct into an E. coli expression strain optimized for membrane protein production

  • Inducing protein expression under controlled conditions

  • Harvesting cells and purifying through affinity chromatography

While E. coli remains the primary expression host, researchers investigating alternative systems should consider that other bacterial proteins like the ATP synthase subunit alpha (atpA) from the same organism have been successfully expressed in yeast, baculovirus, or mammalian cell systems when specific post-translational modifications or folding environments are required.

What are the optimal storage and handling conditions for recombinant BU276?

For maximum stability and activity retention, recombinant BU276 requires specific storage conditions:

ParameterRecommendationNotes
Primary Storage−20°C/−80°CLong-term storage
Working Storage4°CUp to one week
Buffer CompositionTris/PBS-based buffer, pH 8.0Contains 6% Trehalose as stabilizer
ReconstitutionDeionized sterile water0.1-1.0 mg/mL concentration
Cryoprotectant5-50% glycerol (final)Default recommendation: 50%
HandlingBrief centrifugation before openingTo collect contents at vial bottom

Researchers should avoid repeated freeze-thaw cycles as they significantly impact protein integrity and function. For experiments requiring multiple uses, preparing small working aliquots is strongly recommended .

What is the ecological context of Buchnera aphidicola and its proteins?

Buchnera aphidicola represents one of the most well-studied obligate endosymbionts in insects. This bacterium has co-evolved with aphids for over 150 million years, developing an interdependent relationship that enables aphids to survive on nutrient-poor phloem sap .

The ecological importance of Buchnera proteins, including BU276, must be understood within this symbiotic framework:

  • Buchnera supplements essential amino acids missing from the aphid's phloem sap diet

  • The membrane proteins facilitate nutrient exchange between symbiont and host

  • The bacterium resides within specialized host cells called bacteriocytes

  • Reduced genome size (652,115 bp in A. pisum strain) reflects evolutionary streamlining focused on symbiotic functions

Transmission electron microscopy studies have revealed that unlike organelles, Buchnera maintains a distinct membrane system and does not display typical organelle properties, suggesting that proteins like BU276 may function in ways distinct from their homologs in free-living bacteria .

What methodological approaches are suitable for investigating BU276 function?

Investigating the function of BU276 requires a multidisciplinary approach:

Membrane Topology Analysis:

  • Site-directed fluorescence labeling combined with confocal microscopy

  • Protease protection assays to identify accessible domains

  • Substituted cysteine accessibility method (SCAM) to map transmembrane segments

Functional Characterization:

  • Reconstitution into liposomes to assess transport capabilities

  • Patch-clamp electrophysiology if channel activity is suspected

  • Metabolic flux analysis in Buchnera-containing bacteriocytes with BU276 inhibition

Structural Studies:

  • Detergent screening for optimal solubilization (critical for membrane proteins)

  • Cryo-electron microscopy for near-native structural determination

  • NMR spectroscopy on isotopically labeled protein for dynamics studies

In vivo Approaches:

  • RNAi-mediated knockdown in aphid hosts (challenging but feasible)

  • Heterologous expression in E. coli transport-deficient mutants

  • Transcriptional analysis under varying nutrient conditions

When designing experiments, researchers should consider the membrane protein's hydrophobicity and the potential requirement for specific lipid environments to maintain native conformation and function .

How does BU276 compare with other membrane proteins in Buchnera strains?

Comparative genomic analysis reveals interesting patterns in membrane protein conservation across Buchnera strains from different aphid hosts:

StrainHostGenome Size (bp)Membrane Transport SystemBU276 Conservation
BApAcyrthosiphon pisum652,115Three-membrane systemComplete (247 aa)
BSgSchizaphis graminum653,001Three-membrane systemHigh similarity
BBpBaizongia pistaciae~618,000Double membrane systemPresent but modified
BCcCinara cedri425,229Three-membrane systemHighly reduced transporter repertoire

The evolutionary trajectory of BU276 appears to be shaped by distinct selective pressures within different aphid lineages. While the protein is conserved in Buchnera from A. pisum and S. graminum, significant modifications are observed in other lineages. Notably, Buchnera from B. pistaciae has lost all outer-membrane integral proteins, suggesting potential functional adaptations in its BU276 homolog .

Research approaches comparing expression, localization, and function of BU276 across these divergent strains could provide insights into its evolutionary significance and functional adaptation in different symbiotic contexts.

What bioinformatic approaches can predict protein-protein interactions for BU276?

Predicting interaction partners for membrane proteins like BU276 requires specialized bioinformatic pipelines:

Sequence-Based Methods:

  • Coevolution analysis to identify proteins that show correlated evolutionary patterns

  • Domain-based interaction prediction using conserved binding motifs

  • Primary sequence-based interaction site prediction algorithms

Structure-Based Approaches:

  • Homology modeling using related proteins with known structures

  • Molecular docking simulations with potential interacting partners

  • Molecular dynamics simulations to assess stability of predicted complexes

Network-Based Prediction:

  • Guilt-by-association methods using genomic context

  • Gene expression correlation analysis across different conditions

  • Functional linkage networks constructed from multiple evidence types

For BU276 specifically, researchers should consider:

  • Analyzing co-expression patterns with other Buchnera genes in response to aphid dietary changes

  • Examining genomic proximity to other transport-related genes

  • Investigating potential interactions with host aphid transport proteins at the bacteriocyte membrane interface

These computational predictions should ultimately guide experimental validation through techniques such as bacterial two-hybrid assays, co-immunoprecipitation, or crosslinking studies adapted for membrane protein complexes .

How can researchers investigate BU276's role in aphid-Buchnera metabolic integration?

The obligate nature of the aphid-Buchnera symbiosis creates unique challenges and opportunities for studying BU276's role in metabolic integration:

Metabolic Flux Analysis:

  • Stable isotope labeling to trace nutrient transfer between host and symbiont

  • Quantitative proteomics to measure BU276 abundance under different nutritional states

  • Metabolomic profiling of bacteriocytes with modified BU276 expression

Transcriptional Regulation Studies:

  • RNA-Seq analysis comparing BU276 expression across different aphid feeding conditions

  • Identification of potential post-transcriptional control mechanisms, as Buchnera has lost most transcriptional regulators

  • Correlation of BU276 expression with aphid demand for essential amino acids

Functional Transport Assays:

  • Heterologous expression in model systems to assess transport specificity

  • Fluorescent substrate analogs to visualize potential transport in intact bacteriocytes

  • Electrophysiological characterization if channel function is suspected

Of particular interest is how BU276 responds to dietary changes, as studies of related Buchnera proteins have shown that expression can be modulated in response to aphid dietary conditions, despite the bacterium's limited transcriptional regulation capacity. Typically, these responses are subtle (<2-fold changes), requiring sensitive detection methods .

What structural analysis challenges are specific to BU276 and how can they be addressed?

As a membrane protein, BU276 presents specific structural analysis challenges:

Solubilization Challenges:

  • Systematic detergent screening is essential, testing multiple detergent classes (maltosides, glucosides, fos-cholines)

  • Nanodiscs or amphipols may provide more native-like environments than traditional detergents

  • Lipid composition may critically affect stability and should be optimized

Crystallization Difficulties:

  • In meso (lipidic cubic phase) crystallization methods may be more successful than vapor diffusion

  • Antibody fragment co-crystallization can improve crystal contacts for membrane proteins

  • Surface entropy reduction through engineered mutations may enhance crystallization propensity

Alternative Structural Methods:

  • Single-particle cryo-electron microscopy circumvents crystallization requirements

  • Hydrogen-deuterium exchange mass spectrometry provides dynamics information

  • Solid-state NMR on reconstituted samples can yield structural constraints

Quality Assessment:

  • Circular dichroism spectroscopy to verify secondary structure content

  • Size-exclusion chromatography with multi-angle light scattering to assess oligomeric state

  • Thermal stability assays to optimize buffer conditions

For BU276 specifically, researchers should consider that as a symbiont protein, it may have evolved to function in the specialized environment of the bacteriocyte, potentially requiring specific lipids or pH conditions to maintain native structure .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.