Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum UPF0259 membrane protein BUAP5A_271 (BUAP5A_271)

Shipped with Ice Packs
In Stock

Description

Origin and Biological Context

BUAP5A_271 is encoded by the BUAP5A_271 gene in Buchnera aphidicola (strain 5A), a bacterium that resides intracellularly in aphids like Acyrthosiphon pisum . Buchnera has undergone extensive genome reduction due to its obligate symbiosis, retaining genes critical for amino acid biosynthesis (e.g., tryptophan) while losing others unnecessary in aphid-host environments . The BUAP5A_271 gene is annotated as a multi-pass membrane protein, though its exact functional role remains unclear .

Recombinant Expression

BUAP5A_271 is heterologously expressed in E. coli using standard recombinant protein protocols . Key production parameters include:

  • Tag Information: N-terminal or C-terminal tags (e.g., His-tag) are applied to facilitate purification .

  • Purity: >85% as determined by SDS-PAGE .

  • Yield: Typically supplied in quantities of 50 µg, with custom amounts available .

Immunological Studies

BUAP5A_271 is utilized in ELISA assays to detect specific antibodies or study protein interactions. For example, recombinant proteins like this are critical for developing diagnostics targeting Buchnera-aphid symbiosis .

Symbiosis Research

BUAP5A_271 serves as a model for studying gene loss and functional adaptation in symbiotic bacteria. Buchnera’s reduced genome highlights the trade-offs between retained essential functions and lost non-essential genes .

Functional Gaps and Future Directions

Despite its availability, BUAP5A_271’s precise biological function remains undefined. Key areas for further research include:

  1. Functional Characterization: Determining its role in Buchnera’s membrane structure or nutrient exchange with aphids.

  2. Interaction Mapping: Identifying binding partners in aphid cells or Buchnera’s symbiosomes .

  3. Structural Analysis: Resolving its 3D structure via cryo-EM or X-ray crystallography.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
BUAP5A_271; UPF0259 membrane protein BUAP5A_271
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Target Names
BUAP5A_271
Target Protein Sequence
MPITVNKLRHDTHHFFYKKIGAIFFISIFATFMNILIDMFIKPDMHIVSIMENNKFINAS SLLEFIQNMNLNEKHELLKYSILKIMESLISKTTLLGSIIILISVVSEPKKKSIVSSIRT FFLFFPSLFILNFLTTFIIQIGFMLLIIPGILLSIILSLSPIILFFKKNRLLDSIRLSMY ISWKYIKIIGPGVLFWMCGKFILTMLLAHFSLINKNVLFLISNISMNILFSILIIYLFRF YMIFLRS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.