Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum UPF0259 membrane protein BUAPTUC7_273 (BUAPTUC7_273)

Shipped with Ice Packs
In Stock

Description

Evolutionary Significance and Genomic Characteristics

Buchnera aphidicola represents one of the most well-studied obligate endosymbionts in insects, having maintained a strict maternal transmission pattern throughout its evolutionary history with aphid hosts. The bacterium possesses an extremely reduced genome of only 500 to 640 kb containing approximately 450 to 580 protein-coding genes, a dramatic reduction from the 3,000 to 6,000 genes typically found in related free-living bacteria . This genome reduction reflects an evolutionary trajectory of gene loss following the establishment of the symbiotic relationship with aphids.

Despite this extensive genomic reduction, B. aphidicola has remarkably preserved genes essential for amino acid biosynthesis, which comprise approximately 10% of its genome. This retention aligns with its primary nutritional role in synthesizing essential amino acids that are scarce in the aphid's diet of phloem sap . Genomic analyses of different B. aphidicola strains have revealed that most regulatory elements controlling amino acid biosynthesis have been lost, suggesting unique gene expression patterns adapted to the symbiotic lifestyle.

Symbiotic Relationship with Aphids

The relationship between B. aphidicola and its aphid host represents a classic case of obligate mutualism. The bacterium primarily functions as a nutritional supplement factory, converting the abundant non-essential amino acids and sugars from the aphid's phloem diet into essential amino acids required by the host but rare in their natural food source . This nutritional provisioning is particularly crucial for rapidly reproducing aphid species.

Notably, B. aphidicola has lost genes for synthesizing non-essential amino acids that aphids can readily obtain from their diet, while preserving pathways for essential amino acids—a pattern that highlights the complementary metabolic adaptation between host and symbiont . The specific strain associated with Acyrthosiphon pisum (pea aphid) represents one of the most extensively studied systems for understanding the molecular basis of insect-bacterial symbiosis.

Overview of Expression Options

Recombinant BUAPTUC7_273 can be expressed in various host systems, each offering distinct advantages for different research applications. The selection of an appropriate expression system depends on factors including required protein yield, post-translational modifications, and downstream applications.

The following table summarizes the primary expression systems available for recombinant BUAPTUC7_273 production:

Expression SystemAdvantagesYieldProcessing TimePost-translational Modifications
E. coliHigh yield, cost-effective, scalableHighestShortest (days)Minimal
YeastGood yield, some PTMsHighMedium (1-2 weeks)Moderate
Insect cellGood folding, PTMsMediumLonger (2-3 weeks)Extensive
Mammalian cellNative-like folding, full PTMsLowerLongest (3-4 weeks)Most complete

coli Expression System

Expression in E. coli represents the most commonly utilized system for BUAPTUC7_273 production due to its high yield and cost-effectiveness. This system is particularly advantageous for structural studies requiring substantial protein quantities. The commercially available recombinant protein is typically expressed in E. coli with an N-terminal His tag to facilitate purification .

Alternative Expression Systems

For applications requiring more sophisticated post-translational modifications or proper membrane protein folding, several alternative expression systems can be employed:

Yeast expression systems offer a good compromise between yield and post-translational processing, with expression hosts such as SMD1168, GS115, and X-33 commonly used . This eukaryotic system provides certain modifications while maintaining relatively high protein yields.

Insect cell expression using Sf9, Sf21, or High Five cell lines with baculovirus vectors provides more extensive post-translational modifications that may be necessary for proper protein folding and function . This system is particularly valuable for membrane proteins that require specific lipid environments for correct insertion and folding.

Mammalian expression in cell lines such as 293, 293T, NIH/3T3, COS-7, or CHO cells offers the most comprehensive post-translational modification profile, closely resembling the native state of proteins from higher organisms . While yields are typically lower than other systems, the resulting protein may exhibit more native-like properties.

Fusion Tags and Purification Strategies

Recombinant BUAPTUC7_273 can be produced with various fusion tags to facilitate purification and detection. Common fusion partners include:

  • His tag: The most frequently used tag for affinity purification using metal chelate chromatography

  • FLAG tag: Useful for immunodetection and immunoprecipitation

  • MBP (Maltose-Binding Protein): Enhances solubility and provides affinity purification option

  • GST (Glutathione S-Transferase): Facilitates purification and can improve solubility

  • GFP (Green Fluorescent Protein): Allows visualization of expression and localization

The position of the fusion tag can be engineered at either the N-terminal or C-terminal end of the protein, depending on structural considerations and downstream applications . For membrane proteins like BUAPTUC7_273, tag positioning can significantly impact proper membrane insertion and folding.

Potential Functions in Buchnera aphidicola

While the specific function of UPF0259 membrane protein BUAPTUC7_273 remains uncharacterized, its conservation as a membrane protein in the highly reduced genome of B. aphidicola suggests an essential role in the bacterium's physiology. As approximately 10% of the Buchnera genome is dedicated to amino acid biosynthesis pathways critical for the aphid host, membrane proteins may play important roles in the transport of metabolites or signaling molecules between the symbiont and host cells .

The protein's membrane localization positions it at the interface between the bacterial cytoplasm and the host environment, potentially participating in the exchange of nutrients or other essential molecules. Given the specialized metabolic functions of Buchnera in amino acid synthesis, BUAPTUC7_273 might be involved in the transport of amino acid precursors or products.

Research Applications

Recombinant BUAPTUC7_273 serves as a valuable research tool for investigating several aspects of symbiont-host interactions and membrane protein biology:

  1. Structural studies: The purified protein can be used for crystallization attempts to determine its three-dimensional structure, providing insights into its functional mechanisms.

  2. Interaction studies: The protein can be employed in binding assays to identify potential interaction partners from both the bacterial symbiont and the aphid host.

  3. Functional characterization: Reconstitution of the purified protein into liposomes could enable transport assays to assess its potential role in metabolite exchange.

  4. Antibody production: The recombinant protein can serve as an antigen for generating specific antibodies useful for localization studies in the Buchnera-aphid system.

  5. Comparative genomics: As part of the UPF0259 family found across bacterial species, studies with BUAPTUC7_273 may contribute to understanding the functional significance of this protein family.

Custom Production Services

For specialized research needs, custom production services for BUAPTUC7_273 are available from several providers. These services typically include:

  • Codon optimization for the selected expression system

  • Gene synthesis and subcloning into appropriate vectors

  • Expression pilot studies to optimize conditions

  • Scaled-up production and purification

  • Option for tag removal if required

  • Protein reprocessing including renaturation, endotoxin removal, filtration sterilization, and lyophilization

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format preferences, kindly specify them in your order notes. We will strive to fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchasing method and location. We recommend consulting your local distributor for precise delivery estimates.
Note: Our proteins are standardly shipped with regular blue ice packs. Should you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. We recommend storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can utilize this as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
BUAPTUC7_273; UPF0259 membrane protein BUAPTUC7_273
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
Target Names
BUAPTUC7_273
Target Protein Sequence
MPITVNKLRHDTHHFFYKKIGAIFFISIFATFMNILIDMFIKPDMHIVSIMENNKFINAS SLLEFIQNMNLNEKHELLKYSILKIMESLISKTTLLGSIIILISFVSEPKKKSIVSSIRT FFLFFPSLFILNFLTTFIIQIGFMLLIIPGILLSIILSLSPIILFFKKNRLLDSIRLSMY ISWKYIKIIGPGVLFWMCGKFILTMLLAHFSLINKNVLFLISNISMNILFSILIIYLFRF YMIFLRS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and why is it significant in research?

Buchnera aphidicola is an obligate intracellular bacterial symbiont of aphids that maintains a remarkably small genome of approximately 600 kilobase pairs. This bacterium has evolved through a long-term mutualistic relationship with its aphid host, retaining only genes that are essential for the symbiosis . Buchnera is significant in research for several reasons: it represents one of the most extreme examples of genome reduction in bacteria, serves as a model system for studying host-symbiont co-evolution, and provides insights into the minimal genetic requirements for cellular life. The bacterium cannot be cultured outside its host, which presents unique challenges for laboratory investigations but also creates opportunities for studying specialized adaptations in obligate endosymbionts .

What expression systems are available for producing recombinant BUAPTUC7_273?

Several expression systems can be utilized for producing recombinant BUAPTUC7_273, each with distinct advantages:

  • E. coli expression system: This is the most commonly used approach for recombinant BUAPTUC7_273 production, offering high yields and relatively short turnaround times. The protein is typically expressed with an N-terminal His-tag to facilitate purification .

  • Yeast expression systems: These can provide good yields while potentially offering some post-translational modifications that might be important for proper protein folding .

  • Insect cell expression with baculovirus: This system can provide post-translational modifications necessary for correct protein folding or activity maintenance .

  • Mammalian cell expression systems: These offer the most sophisticated post-translational modification capabilities, which may be important if the protein requires specific modifications for activity .

The choice of expression system depends on research objectives, required protein yields, post-translational modification needs, and downstream applications. For structural studies, E. coli expression is often preferred due to higher yields, while functional studies might benefit from eukaryotic expression systems that provide appropriate post-translational modifications .

What is known about the potential function of UPF0259 membrane proteins in Buchnera?

Despite being classified as an uncharacterized protein family (UPF0259), several lines of evidence suggest potential functions for membrane proteins like BUAPTUC7_273 in Buchnera:

  • Genome retention during reductive evolution: The fact that Buchnera has maintained this gene despite extreme genome reduction (600 kbps compared to several million in free-living bacteria) strongly suggests it serves an essential function in the symbiosis .

  • Membrane localization: As an integral membrane protein, BUAPTUC7_273 may participate in:

    • Transport of metabolites between the symbiont and host

    • Signaling processes for symbiont-host communication

    • Maintenance of membrane integrity in the specialized intracellular environment

  • Comparison with flagellar structures: While not directly related to the flagellum complex, other membrane proteins in Buchnera show retention patterns similar to flagellar genes across different lineages, suggesting potential functional relationships in the symbiotic context .

  • Conservation across strains: Patterns of conservation across different Buchnera strains can provide insights into selective pressures maintaining these genes, though specific data for UPF0259 family proteins would require comparative genomic analysis across multiple Buchnera genomes .

The precise function remains undetermined, emphasizing the need for further experimental characterization through approaches such as protein-protein interaction studies, localization experiments, and phenotypic analyses when possible in this challenging system.

How might BUAPTUC7_273 contribute to the Buchnera-aphid symbiosis?

The retention of BUAPTUC7_273 in the highly reduced Buchnera genome suggests it plays a crucial role in the symbiotic relationship. Several hypotheses regarding its contribution include:

  • Nutrient exchange: It may function in transporting essential amino acids or other nutrients that Buchnera synthesizes for its aphid host, or in the uptake of precursors from the host that Buchnera requires .

  • Host recognition and symbiont maintenance: Similar to how flagellar basal bodies in Buchnera may serve as surface signals for host recognition during vertical transmission, membrane proteins like BUAPTUC7_273 could be involved in symbiont recognition processes .

  • Adaptation to the intracellular environment: The protein might help Buchnera adapt to the specialized environment of the aphid bacteriocyte, possibly by maintaining membrane integrity under the unique physiological conditions of the host cell .

  • Developmental coordination: Given that Buchnera cells must coordinate their division with host cell cycles and be transferred to embryos during aphid reproduction, membrane proteins could be involved in signaling pathways that regulate these processes .

Research on other Buchnera membrane proteins has shown that they often serve specialized functions in the symbiosis rather than general cellular functions found in free-living bacteria, suggesting BUAPTUC7_273 may have evolved symbiosis-specific roles .

What challenges are associated with studying membrane proteins from obligate endosymbionts?

Researchers face several significant challenges when studying membrane proteins from obligate endosymbionts like Buchnera:

  • Inability to culture: Buchnera cannot be cultured outside its host, severely limiting the ability to produce native protein in substantial quantities .

  • Complex isolation procedures: Isolating intact Buchnera cells from aphid tissues requires careful dissection and purification to avoid host contamination .

  • Membrane protein solubilization: Membrane proteins are inherently difficult to solubilize and purify in their native conformation, requiring optimization of detergents and buffer conditions .

  • Genetic intractability: The inability to genetically manipulate Buchnera prevents standard approaches like gene knockout or tagging for functional studies .

  • Low abundance: Many membrane proteins are expressed at low levels, making detection and purification challenging .

  • Structural characterization difficulties: Obtaining high-resolution structural data for membrane proteins remains challenging due to difficulties in crystallization or preparation for cryo-EM studies .

These challenges necessitate creative experimental approaches, such as heterologous expression systems, comparative genomics, and specialized isolation techniques as demonstrated in the flagellum basal body isolation study .

What are the optimal conditions for expressing recombinant BUAPTUC7_273 in E. coli?

Based on successful expression protocols for BUAPTUC7_273 and similar membrane proteins, the following conditions are recommended for optimal expression in E. coli:

  • Expression strain selection:

    • BL21(DE3) or C41(DE3)/C43(DE3) strains are preferred for membrane protein expression

    • Rosetta or CodonPlus strains can improve expression if codon bias is an issue

  • Expression vector:

    • pET series vectors with T7 promoter systems

    • N-terminal His-tag fusion for purification, as successfully implemented for BUAPTUC7_273

  • Growth conditions:

    • Initial growth at 37°C to OD600 of 0.6-0.8

    • Temperature reduction to 18-20°C before induction

    • Induction with 0.1-0.5 mM IPTG

    • Extended expression (16-20 hours) at reduced temperature to enhance proper folding

  • Media optimization:

    • Rich media (2xYT or Terrific Broth) supplemented with glucose (0.2-0.5%)

    • Addition of osmolytes like betaine (2.5 mM) and sorbitol (0.5 M) can improve membrane protein folding

  • Membrane fraction recovery:

    • Cell disruption by sonication or high-pressure homogenization

    • Differential centrifugation to isolate membrane fractions

    • Solubilization with mild detergents (DDM, LDAO, or Triton X-100)

These conditions should be systematically optimized through small-scale expression trials before scaling up to larger preparations .

How can researchers optimize purification of BUAPTUC7_273 to maintain structural integrity?

Purification of membrane proteins like BUAPTUC7_273 requires careful optimization to maintain structural integrity:

  • Membrane solubilization:

    • Screen multiple detergents (DDM, LDAO, Triton X-100, CHAPS)

    • Typical starting concentrations: 1% for solubilization, 0.1-0.05% for later purification steps

    • Include protease inhibitors and reducing agents throughout purification

    • Solubilize at 4°C with gentle agitation for 1-2 hours

  • Affinity chromatography:

    • Utilize the N-terminal His-tag for initial capture on Ni-NTA resin

    • Apply gradual imidazole gradients (10-250 mM) for selective elution

    • Keep flow rates low (0.5-1 ml/min) to maximize binding efficiency

  • Secondary purification:

    • Size exclusion chromatography to separate protein aggregates and oligomeric states

    • Ion exchange chromatography if additional purity is required

  • Buffer optimization:

    • Include glycerol (10-20%) to stabilize membrane proteins

    • Maintain detergent above critical micelle concentration

    • pH optimization typically in the range of 7.0-8.0

    • Include stabilizing additives: 50-200 mM NaCl, 5 mM β-mercaptoethanol

  • Storage conditions:

    • Flash-freeze in liquid nitrogen as recommended

    • Store at -80°C with 6% trehalose and/or 50% glycerol

    • Avoid repeated freeze-thaw cycles

  • Quality assessment:

    • SDS-PAGE for purity (>90% is achievable)

    • Size exclusion chromatography for oligomeric state evaluation

    • Circular dichroism to confirm secondary structure integrity

These approaches have successfully yielded purified membrane proteins from Buchnera, as demonstrated in the flagellum basal body isolation protocol .

What analytical techniques are most effective for studying the properties of BUAPTUC7_273?

Several analytical techniques are particularly valuable for characterizing membrane proteins like BUAPTUC7_273:

  • Structural characterization:

    • Negative stain electron microscopy: Valuable for initial visualization of protein complexes, as shown with Buchnera flagellar structures

    • Cryo-electron microscopy: For high-resolution structural determination

    • X-ray crystallography: Challenging but potentially informative if crystals can be obtained

    • Circular dichroism spectroscopy: For secondary structure analysis

  • Functional characterization:

    • Liposome reconstitution: To assess potential transport functions

    • Electrophysiology: If ion channel activity is suspected

    • Binding assays: To identify interaction partners from host or symbiont

  • Proteomic approaches:

    • Mass spectrometry for:

      • Protein identification and verification

      • Post-translational modification detection

      • Protein-protein interaction studies through crosslinking

    • Comparative proteomics across different Buchnera strains

  • Biophysical analyses:

    • Differential scanning calorimetry: For thermal stability assessment

    • Surface plasmon resonance: For binding kinetics

    • Microscale thermophoresis: For interaction studies with potential ligands

  • Localization studies:

    • Immunoelectron microscopy: To determine precise localization within Buchnera cells

    • Fluorescent protein fusions: If expression in model systems is pursued

These techniques should be combined strategically to build a comprehensive understanding of the protein's properties, with emphasis on approaches that require minimal sample amounts given the challenges of obtaining large quantities of the protein .

How should researchers interpret mass spectrometry data for BUAPTUC7_273?

Interpreting mass spectrometry data for membrane proteins like BUAPTUC7_273 requires careful consideration of several factors:

  • Protein identification considerations:

    • Expect lower sequence coverage (typically 30-60%) compared to soluble proteins due to hydrophobic regions resistant to standard proteolytic digestion

    • Validation requires multiple unique peptides (minimum 2-3) for confident identification

    • Cross-reference identified peptides with the theoretical tryptic digest of BUAPTUC7_273

  • Post-translational modification analysis:

    • Search for common modifications (phosphorylation, acetylation)

    • Analyze mass shifts that may indicate membrane-specific modifications

    • Consider using multiple proteases (not just trypsin) to improve coverage of hydrophobic regions

  • Relative quantification approaches:

    • Label-free quantification can compare abundance across different samples

    • Targeted methods (PRM/MRM) can provide higher sensitivity for specific peptides

    • Similar to the flagellum protein enrichment analysis, compare abundance relative to other Buchnera proteins

  • Data deposition and sharing:

    • Follow standardized reporting guidelines

    • Deposit data in repositories like ProteomeXchange/PRIDE as done for Buchnera flagellum studies

  • Common challenges and solutions:

    • Low signal intensity: Use targeted approaches or fractionation

    • Missed cleavages: Consider these in database searches

    • Detergent interference: Use MS-compatible detergents or removal methods

Proper interpretation should include careful validation of identifications through statistical methods and comparison with existing Buchnera proteome datasets when available .

What bioinformatic approaches can predict the structure and function of UPF0259 family proteins?

Several complementary bioinformatic approaches can help predict structure and function of UPF0259 family proteins like BUAPTUC7_273:

  • Sequence-based analysis:

    • Homology detection: PSI-BLAST, HHpred, or HMMER for identifying distant homologs

    • Conservation analysis: Multiple sequence alignment of UPF0259 family members to identify conserved residues that may be functionally important

    • Transmembrane topology prediction: TMHMM, TOPCONS, or MEMSAT for predicting membrane-spanning regions

    • Functional motif prediction: PROSITE or InterProScan for identifying functional domains

  • Structural prediction approaches:

    • AlphaFold2 or RoseTTAFold for generating high-confidence 3D structural models

    • Molecular dynamics simulations to assess stability in membrane environments

    • Coarse-grained simulations for studying potential oligomerization behavior

  • Genomic context analysis:

    • Analyze gene neighborhood across different bacterial species

    • Identify potential operons or functionally related genes

    • Evaluate patterns of gene retention/loss across different Buchnera strains, similar to the flagellar gene analysis

  • Comparative analysis with characterized membrane proteins:

    • Structural comparison with proteins of known function

    • Identification of similar folding patterns or active sites

  • Protein-protein interaction prediction:

    • STRING database analysis

    • Co-evolution analysis to identify potential interaction partners

These computational approaches should inform experimental design and provide testable hypotheses about BUAPTUC7_273 function, particularly important given the challenges of working with proteins from uncultivable symbionts .

How can protein expression levels of BUAPTUC7_273 be accurately quantified across different experimental conditions?

Accurate quantification of BUAPTUC7_273 expression levels requires specialized approaches for membrane proteins:

  • Western blot analysis:

    • Develop specific antibodies against BUAPTUC7_273 or use anti-His antibodies for recombinant tagged protein

    • Include appropriate loading controls (other membrane proteins)

    • Use densitometry for relative quantification

    • Consider the challenges of membrane protein transfer efficiency

  • qRT-PCR for transcript analysis:

    • Design primers specific to BUAPTUC7_273 mRNA

    • Normalize to appropriate reference genes stable under experimental conditions

    • Correlate transcript levels with protein abundance data

  • Mass spectrometry-based quantification:

    • Label-free quantification comparing peptide intensities

    • SRM/MRM (Selected/Multiple Reaction Monitoring) for targeted quantification

    • SILAC or TMT labeling for multiplexed comparative analysis

    • Absolute quantification using isotope-labeled internal standards

  • Fluorescent reporter systems:

    • GFP/YFP fusion constructs (C-terminal fusions to avoid interfering with membrane insertion)

    • Flow cytometry or fluorescence microscopy for population-level or single-cell analysis

  • Experimental considerations:

    • Account for detergent efficiency in membrane protein extraction

    • Ensure complete solubilization for accurate quantification

    • Include appropriate controls for each method

    • Validate results using multiple independent approaches

These approaches have been successfully applied to other Buchnera proteins, including flagellar components, showing their enrichment relative to other proteins in the Buchnera proteome .

What are promising research avenues for understanding BUAPTUC7_273 function in the Buchnera-aphid symbiosis?

Several promising research avenues could advance understanding of BUAPTUC7_273 function:

  • Comparative genomics and evolution:

    • Analysis of UPF0259 protein conservation across different Buchnera strains from diverse aphid species

    • Correlation of protein sequence variations with ecological adaptations of the host aphids

    • Examination of selection pressures on the gene through dN/dS analysis

  • Structural biology approaches:

    • High-resolution structure determination through cryo-EM or crystallography

    • Structure-guided mutagenesis of recombinant protein to identify functional residues

    • Comparative structural analysis with homologous proteins from related bacteria

  • Host-symbiont interaction studies:

    • Localization of BUAPTUC7_273 in Buchnera cells within aphid bacteriocytes

    • Identification of potential interaction partners from both symbiont and host

    • Temporal expression analysis across aphid developmental stages

  • Functional characterization:

    • Heterologous expression in model bacteria to assess phenotypic effects

    • Reconstitution in liposomes to test potential transport functions

    • Proteoliposome assays to measure substrate specificity if transport activity is suspected

  • Integration with systems biology:

    • Correlation of BUAPTUC7_273 expression with metabolomic profiles

    • Network analysis to position the protein within Buchnera's functional pathways

    • Mathematical modeling of potential roles in nutrient exchange

These approaches could overcome the experimental limitations inherent to studying obligate endosymbionts while providing valuable insights into the function of this conserved membrane protein .

How might technological advances improve our ability to study proteins like BUAPTUC7_273?

Emerging technologies offer promising approaches to overcome current limitations in studying proteins from obligate endosymbionts:

  • Advanced structural biology techniques:

    • Microcrystal electron diffraction (MicroED) for structural determination from very small crystals

    • Single-particle cryo-EM with improved detection for smaller proteins

    • Integrative structural biology combining multiple data sources

  • Improved protein expression systems:

    • Cell-free protein synthesis optimized for membrane proteins

    • Nanodiscs and other membrane mimetics for improved stability

    • Synthetic cell systems that better mimic the Buchnera cellular environment

  • Advanced microscopy:

    • Super-resolution microscopy for precise localization within bacteriocytes

    • Correlative light and electron microscopy (CLEM) for structural context

    • Cryo-electron tomography of Buchnera cells within host tissues

  • Synthetic biology approaches:

    • Minimal gene sets in model organisms to test functional hypotheses

    • Engineered bacteria expressing BUAPTUC7_273 under controlled conditions

    • CRISPR-based technologies for studying host factors that interact with Buchnera

  • AI-augmented protein analysis:

    • Machine learning for improved structural prediction

    • Neural networks for functional annotation based on subtle sequence patterns

    • Predictive models of protein-protein and protein-lipid interactions

These technological advances could significantly enhance our ability to study challenging systems like the Buchnera-aphid symbiosis and provide new insights into the functions of proteins like BUAPTUC7_273 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.