Recombinant Buchnera aphidicola subsp. Baizongia pistaciae ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Buchnera aphidicola

Buchnera aphidicola are Gram-negative bacteria that exist as obligate endosymbionts within aphids, residing in specialized cells called bacteriocytes . This symbiotic relationship, established over 100 million years ago, is characterized by Buchnera's provision of essential amino acids to the aphid host, which are otherwise lacking in their phloem-sap diet . In turn, the aphid provides Buchnera with a stable environment and a constant supply of nutrients .

Buchnera aphidicola subsp. Baizongia pistaciae

Buchnera aphidicola exhibits genetic diversity across different aphid lineages . Buchnera aphidicola subsp. Baizongia pistaciae is a specific strain found in the aphid Baizongia pistaciae . This subspecies presents some unique genomic features compared to other Buchnera strains, including a chromosomal segment inversion containing six genes (ygfZprfBlysSlysAlgtthyA) .

ATP Synthase and Subunit b (atpF)

ATP synthase is an essential enzyme complex, also known as F-ATPase, that produces adenosine triphosphate (ATP), the primary energy currency of cells . ATP synthase subunit b (atpF) is a component of the F0 sector of the ATP synthase complex, which is embedded in the membrane and responsible for proton translocation . The atpF subunit is vital for the structural integrity and function of the ATP synthase complex .

Recombinant atpF

Recombinant atpF refers to the atpF subunit of ATP synthase that has been produced using recombinant DNA technology . The gene encoding atpF from Buchnera aphidicola subsp. Baizongia pistaciae is cloned and expressed in a heterologous host, such as E. coli, to produce large quantities of the protein . Recombinant proteins are often used for biochemical studies, structural analysis, and antibody production .

Characteristics of Recombinant Buchnera aphidicola subsp. Baizongia pistaciae atpF

FeatureDescription
Product CodeCSB-CF804643BMZ
SourceExpressed in vitro in E. coli
Tag InfoN-terminal 10xHis-tagged
Amino Acid SequenceMDFNVTIVGQAISFVLFVFFCMKYVWPSVIFIIETRQKEIKDSLTFIENSKKELNIFKEN SKNEIKIIKKNASKIIDSAIQQKTQILKQAYLAAEKEKQTILKQAKLDVMIEYQKARYEL RQKVSKIAVEIAKKIINRSICIEEQNSIISSLIKKI
Protein LengthFull length protein (1-156)
StorageStore at -20°C; for extended storage, conserve at -20°C or -80°C. Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week .
Shelf LifeLiquid form: 6 months at -20°C/-80°C. Lyophilized form: 12 months at -20°C/-80°C .

Function and Significance

  1. ATP Production: The primary role of atpF is to contribute to the ATP synthase complex, which is essential for energy production in Buchnera .

  2. Symbiotic Relationship: ATP production is crucial for the metabolic functions of Buchnera, which supports the aphid's survival by providing essential amino acids .

  3. Evolutionary Studies: Studying the atpF subunit and its variations in different Buchnera strains can provide insights into the evolutionary history and adaptation of these endosymbionts .

  4. Transport Function: Buchnera exhibits a unique transport function shaped by selective constraints within Aphididae lineages. Buchnera from B. pistaciae has a distinctive double membrane system and has lost all its outer-membrane integral proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
atpF; bbp_004; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Target Names
atpF
Target Protein Sequence
MDFNVTIVGQAISFVLFVFFCMKYVWPSVIFIIETRQKEIKDSLTFIENSKKELNIFKEN SKNEIKIIKKNASKIIDSAIQQKTQILKQAYLAAEKEKQTILKQAKLDVMIEYQKARYEL RQKVSKIAVEIAKKIINRSICIEEQNSIISSLIKKI
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases comprise two domains: the F1 domain, containing the extramembrane catalytic core; and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0.
Database Links

KEGG: bab:bbp_004

STRING: 224915.bbp004

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

Basic Understanding and Biological Context

  • What is the role of ATP synthase subunit b (atpF) in Buchnera aphidicola?

    ATP synthase subunit b (atpF) in Buchnera aphidicola functions as a critical component of the F₀ domain of the ATP synthase complex. It forms part of the peripheral stalk that connects the membrane-embedded F₀ sector to the catalytic F₁ sector. This structural role is essential for maintaining the stability of the c-ring/F₁ complex during ATP synthesis . Research shows that in bacteria like Buchnera, the peripheral stalk provides the stationary framework against which the rotary elements of the ATP synthase can turn, thereby enabling efficient energy conversion from the proton gradient to ATP production .

  • How has the ATP synthase complex in Buchnera aphidicola evolved compared to free-living bacteria?

    The ATP synthase complex in Buchnera aphidicola has undergone reductive evolution consistent with its endosymbiotic lifestyle. Compared to free-living relatives like E. coli, Buchnera has maintained the core functionality of ATP synthase while possibly losing regulatory features. The genome of Buchnera Bp (Baizongia pistaciae) is highly reduced at approximately 618 kb , but has remarkably preserved genes essential for energy production, including ATP synthase components. Comparative genomic analyses between Buchnera strains reveal nearly perfect gene-order conservation for ATP synthase subunits, indicating that the onset of genomic stasis for this complex coincided closely with the establishment of aphid symbiosis approximately 200 million years ago .

  • What makes Buchnera aphidicola Bp (Baizongia pistaciae) strain significant for ATP synthase studies?

    The Buchnera aphidicola Bp strain from Baizongia pistaciae represents one of the evolutionarily most basal branches among modern Buchnera strains, having diverged 80-150 million years ago from the common ancestor of other sequenced strains . This evolutionary position makes it particularly valuable for comparative analyses of ATP synthase structure and function. Additionally, the strain has a small, AT-rich genome (615,980 bp for the main chromosome plus a 2,399 bp plasmid) , making it an excellent model for studying how essential energy-producing complexes are maintained in minimal genomes. The retention of ATP synthase genes despite extensive genome reduction underscores their critical importance to the symbiotic relationship.

Experimental Methods and Protocols

  • What are the optimal conditions for expressing recombinant Buchnera aphidicola ATP synthase subunit b in E. coli?

    Expressing recombinant Buchnera aphidicola ATP synthase subunit b in E. coli requires specific optimization due to the high A+T content of the Buchnera genome. Based on protocols for similar membrane proteins , the following conditions are recommended:

    • Expression vector: pET-based vectors with His-tag for purification

    • Host strain: C41(DE3) or C43(DE3), specialized for membrane protein expression

    • Induction conditions: 0.1-0.5 mM IPTG at reduced temperature (18-25°C) for 16-20 hours

    • Buffer composition: Tris/PBS-based buffer (pH 8.0) with 6% trehalose as a stabilizer

    The expression should be verified by SDS-PAGE and Western blotting using anti-His antibodies. For long-term storage, the purified protein should be stored at -80°C with 50% glycerol to prevent freeze-thaw damage .

  • What purification strategy is most effective for isolating functional ATP synthase complexes from Buchnera aphidicola?

    Due to the difficulty of culturing Buchnera outside its host, a combined approach is recommended:

    1. Bacteriocyte isolation: Dissect aphid tissues and isolate bacteriocytes containing Buchnera

    2. Gentle lysis: Use detergent-based methods (0.5-1% digitonin or lauryl maltoside) to solubilize membranes while preserving protein-protein interactions

    3. Differential centrifugation: Separate bacterial cells from host debris

    4. Membrane fraction isolation: Use ultracentrifugation to collect membrane fractions

    5. Affinity chromatography: If working with tagged recombinant proteins

    6. Blue native PAGE: To assess complex integrity and for further purification

    This approach preserves the native state of ATP synthase complexes and allows for functional studies of the isolated enzyme complex. For recombinant subunits expressed in E. coli, standard His-tag purification with imidazole gradient elution is effective .

  • How can I assess the structural integrity and assembly of ATP synthase complexes containing recombinant subunit b?

    Multiple complementary techniques should be employed:

    TechniqueApplicationResolutionAdvantages
    Blue Native PAGEComplex integrityLowQuick assessment of assembled complexes
    In-gel ATPase activity assayFunctional integrityLowDirect correlation between structure and function
    Two-dimensional BN/SDS-PAGESubunit compositionMediumIdentifies all components in complexes
    Proteolytic digestion with MS/MSProtein-protein interfacesHighMaps interaction surfaces
    Cryo-EMStructure of entire complexVery highComplete structural model

    The combination of these techniques allows researchers to determine whether recombinant subunit b properly integrates into the ATP synthase complex and maintains its structural role . Changes in complex formation can be assessed by comparing band patterns on BN-PAGE between wild-type and recombinant subunit-containing complexes.

Comparative and Evolutionary Aspects

Applications in Symbiosis Research

  • How does ATP synthase function in Buchnera aphidicola contribute to the symbiotic relationship with aphids?

    ATP synthase function in Buchnera is central to the symbiotic relationship with aphids in several ways:

    1. Energy provision for nutrient synthesis: ATP generated by the synthase powers the production of essential amino acids and vitamins that aphids cannot synthesize themselves

    2. Metabolic integration: Energy metabolism in Buchnera is tightly integrated with host metabolic pathways

    3. Adaptation to nutritional stress: Studies show that Buchnera protein expression, including ATP synthase components, changes in response to host nutritional status

    4. Population regulation: Energy production capacity may help regulate Buchnera population density within aphid bacteriocytes

    The efficiency of ATP production directly impacts Buchnera's ability to fulfill its primary symbiotic role of nutrient provisioning. Consequently, selection pressure has maintained ATP synthase genes even as the Buchnera genome has been dramatically reduced to ~618 kb , highlighting the essential nature of this complex for symbiotic function.

  • What experimental approaches can be used to study the impact of recombinant ATP synthase subunits on Buchnera-aphid symbiosis?

    Studying the impact of modified ATP synthase components on the Buchnera-aphid symbiosis requires innovative approaches:

    1. Microinjection of recombinant proteins: Direct introduction of modified subunits into bacteriocytes

    2. Ex vivo bacteriocyte culture: Maintaining isolated bacteriocytes with recombinant proteins

    3. Metabolic flux analysis: Tracking nutrient exchange using labeled compounds

    4. Heterologous expression systems: Testing Buchnera ATP synthase components in model bacteria

    5. Aphid fitness measurements: Assessing growth, reproduction, and survival after treatment

    A combined approach could involve introducing recombinant subunit b into isolated bacteriocytes, measuring changes in ATP production, nutrient synthesis, and correlating these with aphid fitness parameters. This would help establish the direct relationship between ATP synthase function and symbiotic efficiency .

  • How can studying ATP synthase in Buchnera aphidicola contribute to our understanding of co-obligate symbioses in aphids?

    ATP synthase research in Buchnera provides valuable insights into co-obligate symbioses:

    1. Metabolic complementarity: Understanding energy production helps explain how Buchnera interacts with secondary symbionts in cases of metabolic complementation

    2. Evolutionary transitions: ATP synthase efficiency may influence whether Buchnera can be replaced or complemented by other symbionts

    3. Functional redundancy: In dual symbioses, energy production may be shared between symbiont partners

    Recent research has revealed that co-obligate symbioses have evolved at least six times across aphid subfamilies . In these cases, Buchnera has lost some essential symbiotic functions and is complemented by additional symbionts. ATP synthase efficiency could be a factor in determining whether such transitions occur, as energy production is fundamental to all other metabolic functions .

Advanced Research Challenges

  • What are the challenges in reconstituting functional Buchnera aphidicola ATP synthase in liposomes for biophysical studies?

    Reconstituting Buchnera ATP synthase in liposomes presents several technical challenges:

    1. Protein source limitations: Inability to culture Buchnera outside its host makes obtaining sufficient native protein difficult

    2. Complex assembly: The multi-subunit nature of ATP synthase complicates complete reconstitution

    3. Membrane composition: Determining the appropriate lipid composition to maintain function

    4. Orientation control: Ensuring correct directional insertion into liposomes

    5. Functional verification: Confirming proton pumping and ATP synthesis activities

    A potential approach involves expressing individual subunits in E. coli, purifying them under non-denaturing conditions, and attempting step-wise reassembly in liposomes with appropriate lipid composition. Alternative strategies include isolating intact complexes from aphid bacteriocytes using mild detergents and reconstituting them directly .

  • How might cryo-EM methodologies be optimized for structural determination of Buchnera aphidicola ATP synthase?

    Optimizing cryo-EM for Buchnera ATP synthase structural studies requires addressing several challenges:

    1. Sample preparation:

      • Use gentle detergents (digitonin 0.5-1%) to extract intact complexes

      • Apply GraFix method (gradient fixation) to stabilize the complex

      • Consider nanodiscs for maintaining native-like lipid environment

    2. Data collection strategy:

      • Collect multiple rotational states to capture conformational cycle

      • Use energy filters to improve signal-to-noise ratio

      • Implement beam-tilt correction for high-resolution features

    3. Computational analysis:

      • Employ focused refinement of F₀ and F₁ regions separately

      • Use particle subtraction to improve alignment of flexible regions

      • Implement 3D variability analysis to capture conformational heterogeneity

    These approaches have been successful for bacterial ATP synthases like that from Bacillus PS3 and could be adapted for Buchnera, potentially revealing unique structural adaptations related to its endosymbiotic lifestyle.

  • What are the potential applications of understanding phosphorylation-based regulation of ATP synthase in host-symbiont metabolic integration?

    Understanding phosphorylation-based regulation of ATP synthase could lead to several applications:

    1. Symbiosis manipulation: Targeted modification of key phosphorylation sites could potentially control symbiont metabolism and population

    2. Agricultural applications: Modifying energy production efficiency in Buchnera could impact aphid fitness and potentially pest management strategies

    3. Evolutionary models: Provides insights into host-microbe metabolic integration and control mechanisms

    4. Synthetic biology approaches: Creating custom symbiotic relationships with defined metabolic interactions

    Research on ATP synthase β subunit phosphorylation has shown that modifications at specific residues (T58, T262) can dramatically alter enzyme function . If similar regulatory mechanisms exist in Buchnera, they could provide a direct mechanism for host control of symbiont metabolism. Understanding these mechanisms could lead to new approaches for studying and potentially manipulating insect-microbe symbioses in agricultural or ecological contexts.

  • How could proteomic and metabolomic integration advance our understanding of ATP synthase function in the Buchnera-aphid system?

    An integrated proteomic-metabolomic approach could provide comprehensive insights through:

    1. Correlation analyses: Linking ATP synthase subunit abundance with:

      • Energy metabolite levels (ATP/ADP ratio, phosphocreatine)

      • Amino acid production (essential amino acids provided to host)

      • Cellular redox state (NAD⁺/NADH ratio)

    2. Flux analyses: Tracing energy and carbon flow between:

      • Glycolysis and TCA cycle intermediates

      • Amino acid biosynthetic pathways

      • Host-symbiont metabolite exchange

    3. Condition-dependent studies: Examining system responses to:

      • Nutritional stress (varying amino acid availability)

      • Temperature changes (affecting metabolic demand)

      • Developmental stages (changing host requirements)

    This approach could identify metabolic bottlenecks, regulatory nodes, and potential intervention points in the symbiotic system. For example, proteomic studies have already shown that Buchnera protein content varies with aphid phenotype , but connecting these changes to specific metabolic outcomes requires integrated analysis.

  • What computational approaches could predict the impact of ATP synthase mutations on Buchnera-aphid symbiotic efficiency?

    Advanced computational approaches for predicting mutation impacts include:

    1. Molecular dynamics simulations:

      • Model structural changes from mutations

      • Predict effects on proton translocation

      • Simulate subunit interactions and complex stability

    2. Metabolic control analysis:

      • Quantify control coefficients for ATP synthase in symbiont metabolism

      • Predict system-wide effects of altered ATP production

      • Model flux distributions under different conditions

    3. Machine learning approaches:

      • Train models on existing mutation-phenotype data

      • Predict outcomes of novel mutations

      • Identify patterns across different symbiont systems

    4. Genome-scale metabolic modeling:

      • Integrate Buchnera and aphid metabolic networks

      • Simulate effects of ATP limitations on nutrient production

      • Predict growth and reproductive outcomes

    These computational approaches could guide experimental design by identifying high-impact mutations for targeted study, potentially accelerating research in this challenging symbiotic system where direct genetic manipulation remains difficult .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.