Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
clsA; cls; bbp_253; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-490
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Target Names
clsA
Target Protein Sequence
MINYLFTITTWLIIISYWFIIIIVTCRILSKRRAISSSAAWLLVIYIIPFIGICTWFLLE EPYLGTRKLKLIKSVWSKKNKHFNNLKSHNYIFENNNSEVARSLFKLCKYRQGISGIKFN KLKLLKNTKDVIKNLVRDIYLAKNTIEIVFYIWKPGGLADNVAIALIQSAKRGIKCRLML DSAGSLEFFRSKWVDMMQQSGIQIVEALKINLLHFFFRRMDLRQHRKFILIDNYITYIGS MNLVDPYLFKKSLGIGQWIDLMTRIEGPISTTMGAIYSCDWEVETGQQISPKRVKNNLII PTYPIKECTSIVQVIASGPGFTEDMIHQALLTAIYSAQQKLTMTTPYLVPSDDLLRAICT AAQRGVEVILIIPKSHDSLLVKWASRVFFSELLESGVKIYQFKKGLLHSKSVLVDKQLSL IGTVNLDMRSLWLNFEITLVIDDKNFGKSLAIIHNEYISHSSLLDPKLWKIRSYWKKIIE KLFYFLSPLL
Uniprot No.

Target Background

Function
This recombinant *Buchnera aphidicola* subsp. *Baizongia pistaciae* cardiolipin synthase (cls) catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, forming cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links

KEGG: bab:bbp_253

STRING: 224915.bbp253

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola cardiolipin synthase and what is its biological significance?

Buchnera aphidicola cardiolipin synthase (cls) is a bacterial-type enzyme that catalyzes the final step in cardiolipin biosynthesis. The enzyme is critical for membrane formation in this endosymbiotic bacterium. Cardiolipin is an essential phospholipid found in bacterial membranes and the inner mitochondrial membrane of eukaryotes, where it constitutes approximately 20% of the total lipid composition . The cls enzyme from B. aphidicola belongs to the bacterial-type cardiolipin synthase family, characterized by a phospholipase D motif that distinguishes it from eukaryotic counterparts .

The biological significance of this enzyme extends beyond basic membrane structure, as cardiolipin plays crucial roles in:

  • Maintaining mitochondrial morphology and function

  • Supporting respiratory chain complexes

  • Facilitating protein complex formation within membranes

  • Contributing to osmotic regulation

Disruption of cardiolipin synthesis in various organisms leads to altered membrane properties, impaired respiratory function, and in some cases, organism death, highlighting its essential nature .

How does the bacterial-type cardiolipin synthase mechanism differ from the eukaryotic counterpart?

Bacterial-type and eukaryotic-type cardiolipin synthases differ fundamentally in their reaction mechanisms and substrate preferences:

Bacterial-type cls (including B. aphidicola cls):

  • Utilizes a transesterification reaction mechanism

  • Typically uses two phosphatidylglycerol (PG) molecules as substrates

  • Contains a phospholipase D motif essential for catalysis

  • Produces cardiolipin and glycerol as products

  • Does not require nucleotide cofactors like CDP

Eukaryotic-type cls:

  • Contains a CDP-alcohol phosphatidyltransferase domain (Cls_cap)

  • Utilizes cytidine diphosphate diacylglycerol (CDP-DAG) and phosphatidylglycerol (PG) as substrates

  • Releases cytidine monophosphate (CMP) during the reaction

  • Distinct catalytic site motifs compared to bacterial enzymes

These mechanistic differences reflect the evolutionary divergence between bacterial and eukaryotic phospholipid biosynthesis pathways and provide valuable targets for studying membrane evolution.

What are the optimal expression and purification conditions for obtaining active recombinant Buchnera aphidicola cardiolipin synthase?

Expression and purification of active Buchnera aphidicola cardiolipin synthase presents several technical challenges due to its membrane-associated nature. Based on current research approaches, the following protocol has proven effective:

Expression System:

  • Host: E. coli expression systems (preferably BL21(DE3) or similar strains)

  • Vector: pET-based vectors with N-terminal His-tag

  • Induction: IPTG induction at lower temperatures (16-20°C) to enhance proper folding

  • Media: Rich media (2xYT or TB) supplemented with appropriate antibiotics

Purification Strategy:

  • Cell lysis using sonication or high-pressure homogenization in buffer containing:

    • 50 mM Tris-HCl (pH 8.0)

    • 300 mM NaCl

    • 10% glycerol

    • 1-2% mild detergent (DDM or CHAPS)

    • Protease inhibitor cocktail

  • Affinity chromatography:

    • Ni-NTA resin for His-tagged protein

    • Washing with increasing imidazole concentrations (10-40 mM)

    • Elution with 250-300 mM imidazole

  • Size exclusion chromatography for further purification and buffer exchange to:

    • 25 mM Tris-HCl (pH 7.5)

    • 150 mM NaCl

    • 5% glycerol

    • 0.03-0.05% DDM

The purified protein should be stored at -80°C with 6% trehalose as a cryoprotectant to maintain stability, with aliquoting recommended to avoid freeze-thaw cycles . Repeated freeze-thaw cycles significantly reduce enzyme activity.

How can the enzymatic activity of Buchnera aphidicola cardiolipin synthase be accurately measured and characterized?

Accurate measurement of Buchnera aphidicola cardiolipin synthase activity requires specialized techniques that address the membrane-associated nature of both the enzyme and its substrates. The following methodological approaches are recommended:

1. In vitro activity assay using purified components:

  • Substrate preparation: Phosphatidylglycerol liposomes (synthetic or extracted)

  • Reaction buffer: 50 mM Tris-HCl (pH 7.5), 10 mM MgCl₂, 100 mM NaCl

  • Reaction conditions: 30-37°C, 30-60 minutes incubation

  • Product detection: Liquid chromatography-mass spectrometry (LC-MS) for direct quantification of cardiolipin formation

2. Complementation assay in cls-deficient bacterial strains:

  • Expression of recombinant B. aphidicola cls in an E. coli clsABC null strain

  • Extraction of total lipids from transformed cells

  • Analysis of lipidome by mass spectrometry to detect cardiolipin species

  • Comparison with control cells containing empty vector

3. Kinetic parameter determination:

  • Vary substrate concentration to determine Km and Vmax values

  • Assess pH and temperature optima (typically pH 7.0-8.0, 30-37°C)

  • Evaluate divalent cation requirements (Mg²⁺, Mn²⁺)

  • Test substrate specificity with different phospholipid variants

The most reliable approach combines these methods, with LC-MS analysis providing definitive identification of the cardiolipin product and its molecular species. A complementation assay in the E. coli clsABC null strain has been shown to successfully demonstrate functional activity of cardiolipin synthases from various sources .

What techniques are most effective for studying the structure-function relationships of Buchnera aphidicola cardiolipin synthase?

Investigating structure-function relationships of Buchnera aphidicola cardiolipin synthase requires a multidisciplinary approach combining molecular, biochemical, and biophysical techniques:

1. Site-directed mutagenesis:

  • Target conserved catalytic residues in the phospholipase D motifs (HxKxxxxD)

  • Create conservative and non-conservative substitutions

  • Assess activity changes using established enzymatic assays

  • Examine effects on substrate binding versus catalytic efficiency

2. Structural characterization:

  • X-ray crystallography of purified protein (challenging for membrane proteins)

  • Cryo-electron microscopy for visualization of protein complexes

  • Nuclear magnetic resonance (NMR) for analyzing protein dynamics

  • Hydrogen-deuterium exchange mass spectrometry to probe conformational changes

3. Protein domain analysis:

  • Construction of truncated variants to identify minimal catalytic domain

  • Creation of chimeric proteins with domains from other bacterial cls enzymes

  • Assessment of domain contributions to substrate specificity and catalytic efficiency

4. In silico approaches:

  • Homology modeling based on related bacterial phospholipase D structures

  • Molecular docking simulations with phosphatidylglycerol substrates

  • Molecular dynamics simulations to examine enzyme-membrane interactions

  • Sequence conservation analysis across multiple bacterial species

5. Biophysical interaction studies:

  • Surface plasmon resonance to measure substrate binding kinetics

  • Isothermal titration calorimetry for thermodynamic parameters of substrate binding

  • Fluorescence spectroscopy with labeled substrates to monitor binding events

These approaches have revealed that bacterial cardiolipin synthases like that from B. aphidicola function as part of larger protein complexes in the membrane, with their activity dependent on proper integration into these complexes .

How do different expression systems affect the yield and activity of recombinant Buchnera aphidicola cardiolipin synthase?

The choice of expression system significantly impacts both yield and activity of recombinant Buchnera aphidicola cardiolipin synthase. The following table compares key expression systems:

For B. aphidicola cardiolipin synthase, E. coli-based expression has been documented to produce functional enzyme when expression conditions are optimized, particularly when using E. coli strains specifically designed for membrane protein expression . The recombinant protein has been successfully expressed in E. coli with an N-terminal His-tag, facilitating purification while maintaining enzymatic activity .

Key factors affecting functional expression include:

  • Induction temperature (lower temperatures often improve folding)

  • Induction time and IPTG concentration

  • Addition of specific lipids to the growth medium

  • Use of specialized promoters with tunable expression levels

What are the key considerations when designing experiments to compare Buchnera aphidicola cardiolipin synthase with other bacterial and eukaryotic cardiolipin synthases?

When comparing Buchnera aphidicola cardiolipin synthase with other cardiolipin synthases, several critical experimental considerations must be addressed:

1. Sequence and phylogenetic analysis:

  • Perform comprehensive sequence alignments of cardiolipin synthases across diverse species

  • Identify conserved motifs and catalytic residues

  • Construct phylogenetic trees to establish evolutionary relationships

  • Distinguish between bacterial-type (phospholipase D motif) and eukaryotic-type (CDP-alcohol phosphatidyltransferase domain) enzymes

2. Substrate specificity assessment:

  • Test activity with various lipid substrates:

    • Archaetidylglycerol (AG) for archaeal enzymes

    • Phosphatidylglycerol (PG) for bacterial and eukaryotic enzymes

    • Mixed substrates to test promiscuity (as seen with archaeal enzymes that can use both AG and PG)

  • Analyze the stereochemical preferences for the glycerol backbone

  • Examine head group and acyl chain specificities

3. Reaction mechanism comparison:

  • Design assays to distinguish between transesterification (bacterial-type) and CDP-dependent (eukaryotic-type) mechanisms

  • Use isotope labeling to track phosphate group transfer

  • Employ site-directed mutagenesis of key catalytic residues to confirm mechanism

  • Test for reversibility of the reaction (bacterial cls reactions are reversible)

4. Functional complementation:

  • Express different cls genes in model organisms lacking endogenous cardiolipin synthase activity

  • Assess rescue of phenotypes in cardiolipin-deficient strains

  • Compare growth rates, membrane integrity, and respiratory function

  • Analyze the cardiolipin profiles produced by different enzymes in vivo

5. Structural analysis:

  • Compare membrane topology and transmembrane domain organization

  • Analyze oligomerization state and protein complex formation

  • Identify structural features that correlate with substrate specificity

  • Determine cofactor requirements for different enzyme types

These comparative approaches have revealed that some eukaryotic organisms, like Trypanosoma brucei, possess bacterial-type cardiolipin synthases despite their eukaryotic status, suggesting ancient evolutionary relationships or potential horizontal gene transfer events .

How can researchers overcome challenges in studying the lipid substrate specificity of Buchnera aphidicola cardiolipin synthase?

Studying lipid substrate specificity of Buchnera aphidicola cardiolipin synthase presents unique challenges due to the hydrophobic nature of both enzyme and substrates. Researchers can address these challenges through:

1. Preparation of defined lipid substrates:

  • Synthetic lipid preparation with controlled acyl chain composition

  • Use of differentially labeled lipids (fluorescent, isotopic) for tracking

  • Generation of liposomes with varying lipid compositions to mimic different membrane environments

  • Development of water-soluble lipid analogs for initial screening

2. Development of robust activity assays:

  • LC-MS-based direct product detection methods

  • Coupled enzyme assays for continuous monitoring

  • Development of high-throughput screening formats

  • Use of substrate competition assays to determine relative preferences

3. Enzyme reconstitution strategies:

  • Incorporation of purified enzyme into nanodiscs with defined lipid composition

  • Proteoliposome reconstitution with varying lipid environments

  • Use of detergent micelles optimized for maintaining enzyme structure and function

  • Cell-free expression systems with direct incorporation into liposomes

4. Addressing the hydrophobic nature of substrates and products:

  • Optimization of lipid solubilization conditions (detergent selection and concentration)

  • Use of native mass spectrometry for studying enzyme-lipid interactions

  • Development of specialized extraction and quantification methods

  • Implementation of surface-sensitive techniques for membrane-associated reactions

5. Leveraging genetic approaches:

  • Expression in model organisms with defined lipid backgrounds

  • Creation of hybrid enzymes to map substrate recognition domains

  • In vivo metabolic labeling to track lipid transformations

  • CRISPR-Cas9 modifications of substrate-generating pathways

Recent research with archaeal cardiolipin synthase has demonstrated the value of these approaches, revealing unexpected substrate promiscuity where the enzyme could utilize both archaeal and bacterial lipid substrates to generate novel hybrid cardiolipin species . Similar methodologies could be productively applied to B. aphidicola cardiolipin synthase studies.

What are the evolutionary implications of bacterial-type cardiolipin synthases found in some eukaryotes, and how does Buchnera aphidicola cls contribute to our understanding?

The discovery of bacterial-type cardiolipin synthases in certain eukaryotes has profound evolutionary implications, challenging conventional views about phospholipid metabolism evolution:

Evolutionary significance:

  • Trypanosoma brucei and some other eukaryotic pathogens possess bacterial-type cardiolipin synthases rather than the eukaryotic-type enzymes found in most eukaryotes

  • This observation supports the hypothesis that trypanosomatids may be among the most ancient living eukaryotes

  • The presence of bacterial-type cls in these organisms may represent retention of an ancestral trait rather than horizontal gene transfer

  • These findings contribute to our understanding of mitochondrial evolution from bacterial endosymbionts

Buchnera aphidicola's contribution to evolutionary understanding:

  • As an obligate endosymbiont, Buchnera aphidicola represents an intermediate stage between free-living bacteria and organelles

  • Its cardiolipin synthase retains bacterial characteristics while functioning within an insect host environment

  • Comparative studies between Buchnera cls and mitochondrial cardiolipin metabolism can illuminate evolutionary transitions

  • The genomic context of cls in Buchnera's reduced genome highlights genes essential for endosymbiotic lifestyle

Implications for endosymbiotic theory:

  • Cardiolipin synthase evolution serves as a marker for tracking the transition from bacterial endosymbionts to organelles

  • The maintenance of bacterial-type cls in some eukaryotes suggests selective advantage of this enzyme type in certain environments

  • Differences in substrate specificity between bacterial and eukaryotic cls enzymes may reflect adaptation to different membrane compositions

  • Understanding cls evolution provides insights into the co-evolution of membranes and membrane proteins

The sequence similarity between Buchnera aphidicola cls and bacterial-type cardiolipin synthases in parasitic protists supports the hypothesis of ancient evolutionary relationships that predate the divergence of major eukaryotic lineages . This perspective challenges conventional views of phospholipid metabolism evolution and suggests that bacterial-type cls enzymes may have been present in early eukaryotes.

How might research on Buchnera aphidicola cardiolipin synthase inform potential therapeutic approaches for diseases involving cardiolipin dysfunction?

Research on Buchnera aphidicola cardiolipin synthase has significant potential to inform therapeutic approaches for diseases involving cardiolipin dysfunction:

Relevant disease connections:

  • Parkinson's disease and Alzheimer's disease: Oxidative stress and lipid peroxidation affecting cardiolipin content in brain tissue is implicated in neurodegeneration

  • Nonalcoholic fatty liver disease: Associated with decreased cardiolipin levels and altered acyl chain composition

  • Heart failure: Cardiolipin alterations contribute to mitochondrial dysfunction in cardiac tissue

  • Diabetes: Cardiolipin deficiency in heart tissue occurs at early stages of diabetes, potentially contributing to cardiovascular complications

  • Cancer: Abnormalities in cardiolipin content and composition have been observed in brain tumors, supporting Warburg's theory of cancer origin from mitochondrial injury

Therapeutic implications of B. aphidicola cls research:

  • Structural insights for drug design:

    • Understanding bacterial cls structure provides templates for selective inhibitors targeting bacterial infections

    • Structural differences between bacterial and human cls offer selective targeting opportunities

    • Rational design of substrate analogs as potential antimicrobials

  • Enzyme replacement strategies:

    • Bacterial cls enzymes might serve as models for engineered variants addressing specific cardiolipin deficiencies

    • The broader substrate specificity of some bacterial-type cls enzymes could inspire therapies for diseases with altered lipid compositions

    • Recombinant cls variants could potentially restore cardiolipin synthesis in compromised tissues

  • Cardiolipin remodeling approaches:

    • Insights from bacterial cls substrate specificity inform strategies to manipulate cardiolipin acyl chain composition

    • Understanding cls regulation may reveal approaches to modulate cardiolipin levels in disease states

    • Bacterial cls reversibility (demonstrated with archaeal cls) suggests potential for remodeling abnormal cardiolipin species

  • Diagnostic applications:

    • Bacterial cls antibodies might have utility in serological tests (similar to cardiolipin in syphilis testing)

    • Engineered cls enzymes could serve as research tools for analyzing membrane composition

    • Understanding cls function contributes to interpreting cardiolipin abnormalities in various diseases

The study of B. aphidicola cls contributes to a fundamental understanding of cardiolipin metabolism that underlies these diverse disease connections. While direct therapeutic applications remain speculative, the growing body of research on bacterial cardiolipin synthases provides promising avenues for addressing diseases where cardiolipin dysfunction plays a key role.

What novel applications could emerge from studying the substrate promiscuity of cardiolipin synthases like those found in Buchnera aphidicola?

The substrate promiscuity observed in some cardiolipin synthases suggests several innovative applications with potential significance for biotechnology and basic research:

1. Engineering novel phospholipids:

  • Design of hybrid cardiolipins with customized properties

  • Controlled synthesis of archaeal-bacterial hybrid lipids like glycerol-archaetidyl-phosphatidyl-cardiolipin (Gro-APCL) demonstrated with archaeal cls

  • Creation of phospholipids with altered head groups or backbone structures

  • Development of phospholipids with enhanced stability for biotechnological applications

2. Membrane engineering applications:

  • Design of artificial membranes with tunable properties

  • Creation of liposomes with novel lipid compositions for drug delivery

  • Engineering of extremophile-inspired membranes for industrial applications

  • Development of synthetic cells with customized membrane compositions

3. Analytical and research tools:

  • Enzyme-based synthesis of labeled cardiolipins for metabolic studies

  • Development of cls-based biosensors for phospholipid detection

  • Use of cls enzymes for in vitro reconstruction of membrane dynamics

  • Creation of lipid probes with novel biophysical properties

4. Potential biotechnological applications:

  • Biocatalysts for green chemistry phospholipid synthesis

  • Enzymatic production of specialized lipids for pharmaceutical applications

  • Development of temperature-stable or pH-resistant enzyme variants

  • Creation of immobilized enzyme systems for continuous lipid production

5. Model systems for evolutionary studies:

  • Reconstruction of ancestral lipid environments

  • Testing hypotheses about the co-evolution of membranes and membrane proteins

  • Investigation of the transition from archaeal to bacterial membrane types

  • Examination of the role of lipid composition in endosymbiotic relationships

Recent work with archaeal cardiolipin synthase demonstrated its ability to utilize both archaeal (archaetidylglycerol) and bacterial (phosphatidylglycerol) substrates, even generating hybrid cardiolipins containing both lipid types—a species not previously observed in nature . Similar exploration of B. aphidicola cls substrate promiscuity could reveal equally innovative applications, particularly given its evolutionary position as an endosymbiont with a specialized host relationship.

Technical Challenges and Solutions

Effective comparative analysis of cardiolipin synthesis pathways across different organisms requires a multifaceted approach integrating genomic, biochemical, and systems biology techniques:

1. Genomic and bioinformatic approaches:

  • Comprehensive genome mining for cardiolipin synthase homologs across diverse species

  • Differentiation between bacterial-type (phospholipase D motif) and eukaryotic-type (CDP-alcohol phosphatidyltransferase domain) enzymes

  • Analysis of genomic context to identify associated genes in cardiolipin metabolism

  • Examination of regulatory elements controlling cls expression

2. Integrated experimental strategies:

  • Heterologous expression of cls genes from different organisms in a common host

  • Standardized activity assays using identical substrate preparations

  • Lipidomic profiling of cardiolipin species produced by different synthases

  • Complementation studies in model organisms with defined genetic backgrounds

3. Methodological standardization across organisms:

  • Development of uniform lipid extraction protocols applicable across species

  • Consistent analytical methods for cardiolipin detection and quantification

  • Standardized growth conditions accounting for organism-specific requirements

  • Normalization approaches for comparing enzyme activities across diverse systems

4. Pathway reconstruction and modeling:

  • In vitro reconstitution of complete cardiolipin synthesis pathways

  • Systems biology modeling of pathway fluxes and regulation

  • Integration of transcriptomic and proteomic data with enzyme activities

  • Evolutionary analysis of pathway components across phylogenetic groups

This approach has revealed significant insights when comparing bacterial and eukaryotic systems. For example, the discovery that Trypanosoma brucei uses a bacterial-type cardiolipin synthase rather than the eukaryotic-type enzyme typically found in most eukaryotes challenged conventional understanding of phospholipid metabolism evolution . Similar comparative studies with B. aphidicola cls could provide insights into endosymbiont-host metabolic integration and the evolution of specialized membrane compositions in obligate intracellular bacteria.

What approaches are most effective for analyzing the integration of Buchnera aphidicola cardiolipin synthase into membrane protein complexes?

Analyzing the membrane integration and protein complex formation of Buchnera aphidicola cardiolipin synthase requires specialized techniques that preserve native interactions while providing high-resolution data:

1. Native membrane complex isolation:

  • Gentle solubilization using digitonin or styrene-maleic acid copolymers

  • Gradient ultracentrifugation for complex separation

  • Blue-native gel electrophoresis (BN-PAGE) for preserving protein-protein interactions

  • Size exclusion chromatography combined with multi-angle light scattering (SEC-MALS)

Blue-native gel electrophoresis has been successfully used to demonstrate that cardiolipin synthase forms part of a large protein complex in the inner mitochondrial membrane, which would likely apply to bacterial cls as well .

2. Protein-protein interaction mapping:

  • Chemical cross-linking followed by mass spectrometry (XL-MS)

  • Co-immunoprecipitation with tagged cls variants

  • Proximity labeling approaches (BioID, APEX)

  • Förster resonance energy transfer (FRET) with fluorescently labeled components

3. Functional complex characterization:

  • Activity assays of isolated complexes versus purified enzyme

  • Reconstitution of minimal functional units

  • Mutational analysis of interaction interfaces

  • Lipid requirement assessment for complex stability

4. Structural analysis of membrane integration:

  • Hydrogen-deuterium exchange mass spectrometry for membrane topology

  • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

  • Cryo-electron microscopy of membrane complexes

  • Atomic force microscopy for membrane protein organization

5. In vivo analysis approaches:

  • Fluorescent protein fusions for localization studies

  • Split fluorescent protein complementation for interaction verification

  • Super-resolution microscopy for nanoscale distribution

  • Correlative light and electron microscopy (CLEM)

Research on cardiolipin synthases has demonstrated that these enzymes typically colocalize with inner mitochondrial membrane proteins and form part of large protein complexes that may include components of the respiratory chain . During depletion of cardiolipin synthase, levels of respiratory complex proteins like cytochrome oxidase subunit IV and cytochrome c1 decreased progressively, suggesting functional integration with these complexes . Similar approaches applied to B. aphidicola cls could reveal host-specific adaptations in membrane protein complex organization in this specialized endosymbiont.

What are the most promising research directions for understanding the role of Buchnera aphidicola cardiolipin synthase in host-endosymbiont interactions?

Future research on Buchnera aphidicola cardiolipin synthase presents several promising directions for understanding host-endosymbiont relationships:

1. Membrane interface characterization:

  • Investigation of cardiolipin distribution at host-endosymbiont membrane interfaces

  • Analysis of cardiolipin's role in stabilizing bacteriocyte membranes

  • Examination of potential cardiolipin exchange between host and endosymbiont

  • Development of imaging techniques to visualize cardiolipin dynamics in live bacteriocytes

2. Metabolic integration studies:

  • Analysis of precursor supply for cardiolipin synthesis across host-endosymbiont boundaries

  • Investigation of regulatory cross-talk affecting cardiolipin synthesis

  • Examination of cardiolipin's role in facilitating nutrient exchange

  • Comparative metabolomics of wild-type versus cls-deficient systems

3. Evolutionary adaptation exploration:

  • Comparison of cls sequences across different Buchnera strains from diverse aphid hosts

  • Analysis of selection pressures on cls genes during endosymbiont genome reduction

  • Investigation of co-evolution between host and endosymbiont membrane systems

  • Reconstruction of ancestral cls sequences to track evolutionary trajectories

4. Functional significance assessment:

  • Development of conditional cls knockdown systems in Buchnera

  • Evaluation of cls essentiality for endosymbiont survival and function

  • Investigation of cardiolipin's role in stress response and environmental adaptation

  • Analysis of cls contribution to vertical transmission of endosymbionts

5. Comparative endosymbiont studies:

  • Analysis of cls function across diverse insect endosymbionts

  • Comparison of cardiolipin profiles between obligate and facultative endosymbionts

  • Investigation of convergent evolution in endosymbiont membrane adaptations

  • Examination of cardiolipin's role in different host cell environments

These research directions would significantly advance our understanding of the biochemical foundations of long-term endosymbiotic relationships. The study of cardiolipin synthase in these systems provides a unique window into the molecular adaptations that enable stable intracellular symbioses, with potential implications for understanding organelle evolution and host-microbe interactions more broadly.

How might synthetic biology approaches utilizing Buchnera aphidicola cardiolipin synthase contribute to membrane engineering applications?

Synthetic biology approaches leveraging Buchnera aphidicola cardiolipin synthase offer exciting possibilities for membrane engineering applications:

1. Designer membrane development:

  • Creation of membranes with tailored cardiolipin content and distribution

  • Engineering of synthetic cells with optimized energy transduction properties

  • Development of membranes with enhanced stability for biotechnological applications

  • Design of asymmetric membranes with specialized domain organizations

2. Enzyme engineering opportunities:

  • Directed evolution of cls for altered substrate specificity

  • Creation of temperature-stable or pH-resistant enzyme variants

  • Development of switchable cls enzymes responsive to external stimuli

  • Engineering of cls proteins with tailored regulatory properties

3. Minimal cell applications:

  • Integration of B. aphidicola cls into minimal cell designs

  • Optimization of membrane composition for synthetic cellular systems

  • Creation of artificial organelles with specialized membrane properties

  • Development of energetically efficient membrane systems

4. Liposome technology advancements:

  • Enzymatic production of cardiolipin-enriched liposomes for drug delivery

  • Development of stable vesicles for harsh environment applications

  • Creation of responsive liposomal systems for controlled release

  • Engineering of membrane interfaces for specific recognition properties

5. Biohybrid systems:

  • Integration of cls-containing membrane systems with electronic components

  • Development of lipid-based biosensors utilizing cardiolipin properties

  • Creation of artificial photosynthetic membranes with optimized energy capture

  • Engineering of membrane-electrode interfaces for bioelectronic applications

The potential substrate promiscuity of bacterial cardiolipin synthases, as demonstrated with archaeal cls enzymes , could enable the enzymatic synthesis of novel lipid structures not found in nature. This capability could be particularly valuable for creating membranes with unique properties or hybrid lipid compositions designed for specific biotechnological applications. The relatively simple bacterial mechanism of cardiolipin synthesis makes B. aphidicola cls an attractive candidate for such engineering efforts.

What computational approaches show the most promise for predicting structure-function relationships in Buchnera aphidicola cardiolipin synthase?

Advanced computational approaches offer powerful tools for predicting structure-function relationships in Buchnera aphidicola cardiolipin synthase:

1. AI-based structure prediction:

  • Application of AlphaFold2 or RoseTTAFold for high-confidence structural models

  • Integration of evolutionary coupling information to identify functionally important residues

  • Refinement of models using molecular dynamics simulations

  • Validation through comparison with experimental data from related proteins

2. Molecular dynamics simulations:

  • All-atom simulations of cls in membrane environments

  • Coarse-grained approaches for studying longer timescale dynamics

  • Investigation of substrate binding and product release pathways

  • Analysis of protein-lipid interactions at the membrane interface

3. Quantum mechanics/molecular mechanics (QM/MM) approaches:

  • Detailed modeling of the transesterification reaction mechanism

  • Calculation of energy barriers for catalytic steps

  • Investigation of transition states and reaction intermediates

  • Prediction of the effects of mutations on catalytic efficiency

4. Network analysis methods:

  • Identification of allosteric communication pathways within the enzyme

  • Detection of co-evolved residue networks important for function

  • Prediction of regulatory sites and protein-protein interaction interfaces

  • Analysis of dynamical communities within the protein structure

5. Integrative computational approaches:

  • Combination of structural bioinformatics with experimental data

  • Integration of genomic, structural, and biochemical information

  • Development of predictive models for substrate specificity

  • Creation of virtual screening platforms for inhibitor or substrate development

These approaches would benefit from the growing body of experimental data on bacterial cardiolipin synthases and could leverage the sequence information available for B. aphidicola cls . Computational predictions could guide experimental design, particularly for mutagenesis studies targeting key catalytic or regulatory residues. Additionally, molecular dynamics simulations could provide insights into how cls functions within the complex membrane environment of this obligate endosymbiont, potentially revealing adaptations specific to its specialized ecological niche.

The bacterial-type mechanism of cardiolipin synthesis, involving the direct transesterification of two phosphatidylglycerol molecules , presents a well-defined reaction for computational analysis that could yield insights applicable beyond B. aphidicola to the broader understanding of phospholipid metabolism across diverse organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.