Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Cytochrome o ubiquinol oxidase protein CyoD (cyoD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
cyoD; bbp_414; Cytochrome bo(3 ubiquinol oxidase subunit 4; Cytochrome o ubiquinol oxidase subunit 4; Cytochrome o subunit 4; Oxidase bo(3 subunit 4; Ubiquinol oxidase polypeptide IV; Ubiquinol oxidase subunit 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Target Names
cyoD
Target Protein Sequence
MLKNRYLKYLFILILLSILSIMPIFAIIYRIFSRNYLYAFIIVCLFFQILAHIKFFLNLD FSLEQRWKLISVIFSLVVGLIILLGSIWVIKNLNNNLCIM
Uniprot No.

Target Background

Function

Cytochrome bo(3) ubiquinol terminal oxidase is a key component of the aerobic respiratory chain in E. coli, predominantly expressed under high aeration conditions. In addition to electron transfer, it exhibits proton pump activity across the membrane, transporting 2 protons per electron.

Database Links

KEGG: bab:bbp_414

STRING: 224915.bbp414

Protein Families
Cytochrome c oxidase bacterial subunit 4 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Cytochrome o ubiquinol oxidase protein CyoD in Buchnera aphidicola?

Cytochrome o ubiquinol oxidase protein CyoD functions as subunit IV of the cytochrome bo(3) ubiquinol terminal oxidase complex, a critical component of the aerobic respiratory chain in Buchnera aphidicola. This complex predominates under high aeration conditions and performs dual functions: electron transfer and proton pumping across the membrane . The CyoD protein works in concert with other subunits (CyoA, CyoB, and CyoC) to facilitate electron transfer from ubiquinol to oxygen while simultaneously pumping protons across the membrane at a ratio of approximately 2 protons per electron . This proton-pumping activity generates an electrochemical gradient that can be utilized for ATP synthesis.

The retention of functional respiratory chain components like CyoD is particularly significant considering the extreme genome reduction observed in Buchnera aphidicola, which has undergone substantial genomic streamlining during its 100-200 million year evolutionary history as an obligate endosymbiont . Genome analysis reveals that genes involved in energy production and conservation are among the most preserved functional categories during the reduction process, comprising approximately 8.29% of the remaining genes in some Buchnera strains . This conservation highlights the critical importance of energy metabolism, despite the otherwise simplified metabolic networks found in this endosymbiont.

How does CyoD interact with other components of the respiratory chain?

CyoD forms part of a highly integrated respiratory system, with multiple verified protein-protein interactions essential for function. Based on interaction network analyses, CyoD demonstrates strong associations with:

  • Cytochrome bo₃ Complex Subunits: CyoD forms critical interactions with CyoA, CyoB, and CyoC with interaction confidence scores of >0.99 . These interactions are essential for proper complex assembly and function, with CyoD specifically contributing to the structural integrity necessary for proton translocation.

  • NADH Dehydrogenase Components: Significant functional coupling exists between CyoD and the NADH dehydrogenase I chain C/D (nuoCD), with an interaction confidence score of 0.999 . This high-confidence interaction highlights the coordinated activity between primary electron input (Complex I) and terminal oxidase (Cytochrome bo₃) systems.

The table below summarizes key protein-protein interactions involving CyoD:

Interaction PartnerConfidence ScoreFunctional RelationshipReference
CyoB0.999Cytochrome O ubiquinol oxidase subunit I
CyoC0.999Cytochrome O ubiquinol oxidase subunit III
CyoA0.999Cytochrome O ubiquinol oxidase subunit II
NuoCD0.999NADH dehydrogenase subunit C/D

These interactions form the foundation for electron transfer and proton pumping activities, demonstrating how CyoD contributes to energy metabolism within the highly reduced metabolic network of Buchnera aphidicola.

What is the evolutionary significance of cyoD retention in the reduced genome of Buchnera aphidicola?

The retention of cyoD in the highly reduced genome of Buchnera aphidicola represents a fascinating case study in endosymbiont evolution. This persistence is particularly noteworthy in the context of the extensive genome reduction that has occurred during the 100-200 million years of endosymbiotic association between Buchnera and its aphid hosts .

Comparative genomic analyses of different Buchnera strains reveal that gene reduction is not a random process but follows distinct patterns based on functional constraints . The genome of Buchnera aphidicola from Baizongia pistaciae (BBp) maintains functional respiratory components including cyoD, despite substantial losses in other metabolic pathways . This selective retention provides compelling evidence that energy production remains an essential function even in highly streamlined genomes.

Several factors contribute to the evolutionary significance of cyoD retention:

  • Metabolic Integration: The endosymbiotic relationship has evolved intricate metabolic integration between host and symbiont. The retention of functional respiratory chain components suggests that Buchnera's energy metabolism remains critical for providing nutritional benefits to the host, particularly in amino acid biosynthesis .

  • Differential Gene Loss: When comparing gene content across Buchnera strains from different aphid hosts (Acyrthosiphon pisum, Schizaphis graminum, Baizongia pistaciae, and Cinara cedri), respiratory chain components show differential patterns of loss . This non-uniform loss pattern indicates varying selective pressures across different host-symbiont systems.

  • Functional Constraints: Metabolism serves as a powerful evolutionary force in insect endosymbionts, with genes involved in essential metabolic functions showing greater conservation than those with peripheral functions . The retention of cyoD illustrates how functional constraints can override the general trend toward genome minimization.

The evolutionary maintenance of the cytochrome o ubiquinol oxidase complex in Buchnera demonstrates the critical balance between genome streamlining and functional preservation in obligate endosymbionts, highlighting metabolism as a fundamental constraint on reductive genome evolution.

What experimental challenges arise when expressing recombinant CyoD from Buchnera aphidicola?

The expression and purification of recombinant CyoD from Buchnera aphidicola presents several significant challenges that researchers must address:

  • Membrane Protein Properties: As an integral membrane protein with multiple transmembrane domains, CyoD is inherently difficult to express in soluble form . The hydrophobic regions that anchor the protein in the membrane create challenges for proper folding in heterologous expression systems, often leading to inclusion body formation or misfolding.

  • Subunit Dependency: CyoD functions as part of a multi-subunit complex with CyoA, CyoB, and CyoC . Isolated expression may result in improperly folded protein lacking its native interaction partners. The high confidence scores (0.999) for interactions between these subunits suggest that co-expression may be necessary to obtain functionally relevant structures .

  • Endosymbiont-Specific Characteristics: Buchnera aphidicola has evolved as an obligate endosymbiont for 100-200 million years , resulting in genomic and proteomic characteristics that differ from conventional expression hosts. These differences include altered codon usage patterns, specialized metabolic adaptations, and potentially unique post-translational requirements.

  • Low Natural Abundance: As Buchnera exists exclusively within specialized aphid cells (bacteriocytes) and cannot be cultured independently , direct purification from natural sources is impossible, necessitating reliance on recombinant systems.

A methodological framework to address these challenges includes:

ChallengeRecommended ApproachImplementation Strategy
Membrane integrationSpecialized expression strainsUse C41(DE3)/C43(DE3) E. coli strains designed for membrane protein expression
Protein solubilityDetergent screeningSystematic testing of mild detergents (DDM, LMNG) for optimal solubilization
Complex assemblyCo-expression strategiesPolycistronic constructs expressing multiple cyo operon components
Functional verificationReconstitution assaysIncorporation into proteoliposomes for activity assessment

A stepwise experimental approach beginning with fusion-tag strategies (such as MBP or SUMO tags) to enhance solubility, followed by careful detergent optimization and functional reconstitution, offers the most promising path to obtaining functional recombinant CyoD.

How can researchers assess the proton-pumping activity of recombinant CyoD in experimental systems?

Characterizing the proton-pumping activity of recombinant CyoD requires specialized techniques that can detect and quantify proton translocation across membranes. Since CyoD functions as part of the cytochrome bo₃ ubiquinol oxidase complex, most functional assays require reconstitution of the full complex or at minimum its functional core components .

The following analytical approaches provide complementary information about proton-pumping activity:

  • Proteoliposome-Based Assays:

    Reconstituted proteoliposomes containing purified cytochrome bo₃ complex with CyoD provide an excellent system for assessing proton translocation. pH-sensitive fluorescent probes such as ACMA (9-amino-6-chloro-2-methoxyacridine) can detect changes in ΔpH upon addition of electron donors like ubiquinol. The proton-pumping efficiency of a functional complex typically exhibits a stoichiometry of approximately 2 H⁺/e⁻ .

  • Oxygen Consumption Coupling:

    Clark-type oxygen electrode measurements coupled with pH monitoring can establish the relationship between electron transfer and proton translocation. The respiratory control ratio (ratio of respiration rates in the presence and absence of uncouplers) provides a quantitative indicator of coupling efficiency.

  • Spectroscopic Techniques:

    Stopped-flow spectroscopy can monitor rapid electron transfer events during catalysis, providing insights into the kinetics of electron transfer coupled to proton pumping. For cytochrome bo₃ complexes, monitoring absorbance changes at specific wavelengths corresponding to heme o transitions reveals electronic changes associated with catalytic events.

The following experimental parameters are critical for reliable proton-pumping assays:

ParameterRecommended ConditionsRationale
Reconstitution LipidsE. coli polar lipids or synthetic mixturesMimics native membrane environment
Lipid-to-Protein Ratio50:1 to 100:1 (w/w)Ensures proper protein orientation
Buffer System10 mM HEPES, 100 mM KCl, pH 7.4Low buffering capacity allows pH detection
Electron DonorDecylubiquinol (50-100 μM)Physiologically relevant substrate
ControlsValinomycin/FCCP (uncoupled conditions)Distinguishes proton pumping from other activities

For definitive characterization, combining at least two complementary techniques is recommended to establish the functional integrity of the recombinant CyoD in the context of the cytochrome bo₃ complex.

How do mutations in conserved residues of CyoD affect respiratory chain function in Buchnera aphidicola?

Investigating the effects of mutations in CyoD on respiratory chain functionality provides valuable insights into structure-function relationships. While direct genetic manipulation of Buchnera is challenging due to its obligate endosymbiotic nature , several indirect approaches can yield meaningful data:

  • Comparative Genomics Analysis:

    Natural variants of the cyoD gene exist across different Buchnera strains from distinct aphid lineages, including those from Acyrthosiphon pisum, Schizaphis graminum, Baizongia pistaciae, and Cinara cedri . Systematic comparison of these variants in conjunction with metabolic profiles of their respective host aphids can reveal correlations between specific amino acid substitutions and symbiotic fitness.

  • Heterologous Expression Studies:

    By introducing Buchnera cyoD variants into model systems such as E. coli cyo mutants, researchers can assess complementation efficiency. The high confidence interaction scores (0.999) between CyoD and other respiratory components provide a basis for predicting which residues are likely to be critical for function .

  • Structural Impact Assessment:

    Using molecular modeling approaches, researchers can predict how specific mutations might affect protein stability, complex assembly, and proton translocation pathways. The predicted functional impacts of mutations in different regions include:

Mutation RegionPredicted Functional ImpactMetabolic Consequences
Transmembrane helicesDisruption of membrane integrationSevere reduction in oxidase activity
Subunit interface residuesWeakened interaction with CyoA/B/CReduced efficiency of electron transfer
Conserved charged residuesDisruption of proton translocationUncoupling of electron transfer from proton pumping
Peripheral regionsMinimal effect on core functionSubtle changes in regulation
  • Metabolic Consequences:

    Mutations affecting CyoD function would have cascading effects on cellular energetics, including:

    • Reduced ATP production capacity

    • Altered redox balance affecting biosynthetic pathways

    • Impaired amino acid biosynthesis (a primary function of Buchnera for its aphid host)

    • Changes in membrane potential affecting transport processes

Understanding these structure-function relationships not only provides fundamental insights into the mechanism of proton translocation but also illuminates how evolutionary constraints have shaped the retention of respiratory chain components in this highly reduced bacterial genome.

What expression systems are most effective for producing functional recombinant CyoD?

Selecting an appropriate expression system for producing functional recombinant CyoD requires careful consideration of the protein's membrane-associated nature and the specialized metabolic context of Buchnera aphidicola. Based on current research practices for similar proteins, the following expression systems offer distinct advantages:

  • Bacterial Expression Systems:

    a. E. coli C41(DE3)/C43(DE3) Strains:

    • Specifically engineered for membrane protein expression

    • Advantages: Genetic similarity to Buchnera (both Gammaproteobacteria); well-established protocols

    • Optimization strategies: Low-temperature induction (16-20°C); reduced inducer concentration

    b. E. coli BL21(DE3) with pLysS:

    • Provides tighter regulation of potentially toxic membrane protein expression

    • Typical yield: 0.5-2 mg/L culture

  • Cell-Free Expression Systems:

    • Allows direct incorporation into nanodiscs or liposomes during synthesis

    • Advantages: Rapid production; avoids toxicity issues; enables high-throughput screening

    • Recommended detergents: DDM, LMNG, or GDN for solubilization

Comparative performance metrics for CyoD expression across systems:

Expression SystemTypical YieldFunctional ActivityPurification ComplexityTime Requirement
E. coli C41(DE3)1-3 mg/LModerateModerate3-5 days
Cell-free system0.1-0.5 mg/mLHighLow1-2 days
Co-expression with CyoABC0.5-1.5 mg/LVery highHigh5-7 days

For optimal results, the recommended protocol includes:

  • Vector Selection: pET28a or pBAD vectors with C-terminal His-tags

  • Induction Conditions: 0.1 mM IPTG or 0.002% arabinose at OD₆₀₀ = 0.6-0.8

  • Expression Temperature: 18°C for 16-20 hours post-induction

  • Membrane Extraction: Gentle solubilization using 1% DDM or 0.5% LMNG

  • Purification Strategy: IMAC followed by size exclusion chromatography

For functional studies, co-expression with other cytochrome bo₃ complex components (CyoA, CyoB, CyoC) is strongly recommended to ensure proper folding and assembly of the complex, given their high confidence interaction scores (0.999) .

How can researchers effectively study the in vivo function of CyoD given the obligate endosymbiotic nature of Buchnera aphidicola?

Studying the in vivo function of CyoD presents unique challenges due to Buchnera's obligate endosymbiotic lifestyle within aphid host cells . Researchers must employ creative approaches that work within these constraints:

  • Aphid-Buchnera System Manipulations:

    a. RNA Interference (RNAi) Approaches:

    • Design RNAi constructs specific to Buchnera cyoD

    • Delivery through microinjection or feeding of dsRNA to aphid hosts

    • Measure impacts on Buchnera population, aphid fitness, and metabolic profiles

    • Limitations: Variable penetration into bacteriocytes

    b. Antibiotic Perturbation:

    • Selective inhibition of respiratory chain components using targeted antibiotics

    • Comparative analysis of phenotypes to infer CyoD-specific functions

  • Metabolic and Physiological Assessments:

    a. Respirometry of Isolated Bacteriocytes:

    • Measure oxygen consumption rates of freshly isolated bacteriocytes

    • Use specific inhibitors to dissect contribution of cytochrome bo₃ oxidase

    • Methodology: Clark-type electrode with sequential addition of inhibitors

    b. Metabolomics Approaches:

    • Comparative metabolic profiling of normal vs. perturbed Buchnera-aphid systems

    • Focus on energy metabolites (ATP/ADP ratio, NAD⁺/NADH) and amino acid production

  • Genomic and Transcriptomic Analyses:

    a. Comparative Genomics:

    • Natural variants of cyoD across different Buchnera strains provide evolutionary experiments

    • Correlation of sequence variations with host adaptation and metabolic capabilities

    b. Transcriptional Response Analysis:

    • RNA-Seq of Buchnera under different host physiological states

    • Examine co-expression patterns of cyoD with other metabolic genes

The following experimental design considerations are crucial for meaningful in vivo studies:

Experimental ApproachKey ControlsExpected OutcomesTechnical Challenges
RNAi targeting cyoDNon-targeting dsRNAReduced respiratory capacityDelivery efficiency
Bacteriocyte respirometrySpecific inhibitors of each complexQuantitative contribution to respirationMaintaining viability of isolated cells
Comparative genomicsMultiple lineagesIdentification of selective pressuresLimited availability of diverse genomes

For comprehensive functional characterization, a multi-pronged approach combining techniques from manipulation, localization, metabolic assessment, and genomic analysis is recommended to overcome the inherent limitations of studying this obligate endosymbiont.

What analytical techniques can determine if recombinant CyoD is properly folded and functional?

Assessing the proper folding and functionality of recombinant CyoD is essential for meaningful biochemical and structural studies. Given its role as a membrane protein component of the cytochrome bo₃ complex, standard soluble protein characterization methods must be adapted for membrane protein environments. The following analytical techniques provide complementary information about protein quality:

  • Biophysical Characterization:

    a. Circular Dichroism (CD) Spectroscopy:

    • Evaluates secondary structure content

    • Far-UV spectra (190-260 nm) can confirm α-helical content expected for transmembrane domains

    • Thermal denaturation curves assess protein stability

    • Comparison with predicted secondary structure from homology models provides validation

    b. Fluorescence Spectroscopy:

    • Intrinsic tryptophan fluorescence reports on tertiary structure

    • Detergent screening can be performed by monitoring spectral changes

    • Blue-shifts in emission maximum indicate proper folding in membrane-mimetic environments

  • Functional Assessments:

    a. Ubiquinol Oxidase Activity Assays:

    • When reconstituted with other Cyo subunits, measure ubiquinol-dependent oxygen consumption

    • Clark-type electrode or oxygen-sensitive fluorescent probes can monitor activity

    • Typical activity rates for functional cytochrome bo₃: 200-500 nmol O₂/min/mg protein

    b. Proton Pumping Assays (as described in section 3.2):

    • Functional CyoD contributes to proton translocation activity

    • H⁺/e⁻ ratio should approach theoretical value of 2.0 for properly folded complex

  • Structural Integrity Analysis:

    a. Size Exclusion Chromatography (SEC):

    • Monitors monodispersity and complex formation

    • When combined with multi-angle light scattering (SEC-MALS), provides absolute molecular weight

    • Well-folded CyoD should elute primarily in complex with partner subunits rather than as aggregates

    b. Limited Proteolysis:

    • Properly folded membrane proteins show distinct proteolytic patterns

    • Time-course digestion with proteases like trypsin or chymotrypsin

    • Analysis by SDS-PAGE or mass spectrometry

    • Protected fragments correspond to structured regions

  • Interaction Verification:

    a. Co-immunoprecipitation:

    • Confirm interaction with other Cyo subunits (particularly CyoA, CyoB, and CyoC)

    • Pull-down assays with tagged versions of interaction partners

    • Verify by western blotting or mass spectrometry

    b. Microscale Thermophoresis (MST):

    • Quantifies binding affinity for interaction partners

    • Can be performed in detergent solutions

    • Expected Kd values for subunit interactions: low nanomolar range

The following quality control metrics indicate properly folded and functional CyoD:

ParameterAcceptable RangeIndication of Problems
α-helical content50-65%<40% suggests misfolding
Thermal stability (Tm)>45°C in detergent<35°C indicates instability
SEC profile>90% monodisperseSignificant void volume peak suggests aggregation
Ubiquinol oxidase activity>200 nmol O₂/min/mg<50 nmol O₂/min/mg indicates non-functional protein
H⁺/e⁻ ratio1.5-2.0<1.0 indicates uncoupled or damaged complex

By applying multiple complementary techniques, researchers can confidently assess whether recombinant CyoD is properly folded and suitable for downstream applications such as structural studies or functional characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.