Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Cytochrome o ubiquinol oxidase subunit 3 (cyoC)

Shipped with Ice Packs
In Stock

Description

Evolutionary History and Genomic Features

Buchnera aphidicola represents a fascinating case of reductive genome evolution resulting from its obligate endosymbiotic relationship with aphids. The Buchnera strain from Baizongia pistacea (BBp) diverged approximately 80-150 million years ago from the common ancestor of other sequenced Buchnera strains, representing one of the most basal branches in modern Buchnera phylogeny . Despite this ancient divergence, the genome exhibits remarkable conservation in gene order across different strains, suggesting that genomic stasis was established early in the symbiotic relationship, approximately 200 million years ago .

The genome of Buchnera aphidicola from Baizongia pistacea is highly reduced at approximately 618 kilobase pairs (kbp), reflecting extensive genome reduction that occurred early in the establishment of the symbiotic relationship with aphids . Despite this reduction, essential metabolic pathways and proteins necessary for the symbiotic relationship have been conserved, including the cyoC gene.

Symbiotic Relationship with Aphids

Buchnera aphidicola resides within specialized host cells called bacteriocytes, which are remarkably large cells measuring approximately 100 μm in diameter . These cells are characterized by their hyper-polyploidy, with DNA content ranging from 16- to 256-ploidy throughout the lifecycle of the aphid host . This high ploidy level is thought to support the metabolically demanding role of these cells in maintaining the symbiotic relationship.

The bacteriocytes form organ-like structures called bacteriomes, which also contain smaller, flattened sheath cells that surround the bacteriocytes . These specialized cellular arrangements facilitate the intimate metabolic exchange between the symbiont and host, with Buchnera providing essential amino acids and vitamins that aphids cannot synthesize or obtain in sufficient quantities from their diet of plant phloem sap .

Metabolic Significance

Cytochrome o ubiquinol oxidase is a critical component of the respiratory chain in many bacteria, functioning as a terminal oxidase that catalyzes the transfer of electrons from ubiquinol to oxygen, coupled with proton translocation across the membrane. In the context of Buchnera's highly reduced genome, the retention of this protein complex suggests its essential role in maintaining cellular respiration and energy production.

The cyoC subunit specifically serves as one of the membrane-embedded components of the cytochrome o ubiquinol oxidase complex. Its hydrophobic nature, evident from the amino acid sequence, facilitates its integration into the bacterial membrane where it participates in the electron transport process.

Comparative Analysis with Other Subspecies

The cyoC protein is conserved across different Buchnera subspecies, reflecting its functional importance. Similar recombinant products are available from other Buchnera strains, such as the cyoC from Buchnera aphidicola subsp. Schizaphis graminum .

Table 2: Comparison of cyoC Products from Different Buchnera Subspecies

CharacteristicB. aphidicola subsp. Baizongia pistaciaeB. aphidicola subsp. Schizaphis graminum
Product NameCytochrome o ubiquinol oxidase subunit 3Cytochrome o ubiquinol oxidase subunit 3
Commercial AvailabilityAvailable as recombinant proteinAvailable as recombinant protein
Supplier Examplee-scapebio.comMyBioSource.com
Price RangeVaries by supplier and quantityApproximately $1,470.00

Evolutionary Studies

The study of proteins like cyoC from Buchnera aphidicola provides valuable insights into the process of reductive genome evolution. By examining the conservation and functional adaptation of respiratory chain components in this endosymbiont, researchers can better understand how obligate intracellular lifestyles shape protein function and genome architecture over evolutionary time .

Research into the genomic stasis of Buchnera, which coincided closely with the establishment of symbiosis with aphids approximately 200 million years ago, has highlighted the importance of conserved proteins like cyoC in maintaining essential cellular functions despite extensive gene loss .

Symbiosis Research

Recombinant proteins from Buchnera, including cyoC, serve as valuable tools for investigating the molecular basis of host-symbiont interactions. Given that Buchnera supplies its aphid host with essential nutrients that the insect cannot synthesize or obtain from its diet, understanding the energy metabolism of the symbiont is crucial for elucidating this nutritional relationship .

The intracellular environment of bacteriocytes, where Buchnera resides, presents a unique metabolic context. These cells are highly polyploid and metabolically active, providing the symbiont with essential amino acids and other metabolites that Buchnera can no longer produce due to its reduced genome . The cyoC protein, as part of the respiratory chain, plays a role in the energy metabolism that supports this exchange.

Immunological Techniques

The recombinant cyoC protein is suitable for use in enzyme-linked immunosorbent assays (ELISA) and other immunological techniques . These applications can be valuable for detecting and quantifying Buchnera in experimental settings or for studying the expression of respiratory chain components under different conditions.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format preference, please indicate your requirement when placing your order, and we will fulfill it to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize the development of that tag type.
Synonyms
cyoC; bbp_415; Cytochrome bo(3 ubiquinol oxidase subunit 3; Cytochrome o ubiquinol oxidase subunit 3; Cytochrome o subunit 3; Oxidase bo(3 subunit 3; Ubiquinol oxidase polypeptide III; Ubiquinol oxidase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-194
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Target Names
cyoC
Target Protein Sequence
MKKKYKIDTNIFSKELLGFWLYLMSDCIIFCTLFSVYFILVDNVAQGPSGHNIFQNNLII IETFLLLFSSFSCNLVLFEMKNKNLYMVFLWLGITFLLGLLFVFLELFEFFHLINLGFGP TRSGFLSSFFVLIATHGIHVISGLIWIIVMIKYVYTFNITNLIYYRMLCLNLFWHFLDIV WVFIFSFVYLFGMV
Uniprot No.

Target Background

Function
Cytochrome bo(3) ubiquinol terminal oxidase is the primary component of the aerobic respiratory chain in E. coli when cells are grown under high aeration conditions. In addition to electron transfer, it exhibits proton pump activity across the membrane, pumping 2 protons per electron.
Database Links

KEGG: bab:bbp_415

STRING: 224915.bbp415

Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and what role does it play in aphid biology?

Buchnera aphidicola is an obligate endosymbiont found exclusively in aphid species. It resides within specialized structures called bacteriocytes, where its primary function is the production of essential amino acids that aphids cannot synthesize themselves. This mutualistic relationship is critical for aphid survival, as aphids provide Buchnera with non-essential amino acids and other nutrients, while Buchnera synthesizes essential amino acids that are lacking in the aphid's phloem-based diet. The relationship involves selective provisioning by the aphid, which controls the production of essential amino acids and allows adaptation to the nutritional content of the current host plant .

The evolution of this symbiotic relationship has led to significant genome reduction in Buchnera, with many non-essential genes being lost over time. For example, the Buchnera aphidicola from Diuraphis noxia (BDn) has a genome of only 636,266 bp containing 578 protein coding genes, 32 tRNA genes, 3 rRNA genes, and 3 other ncRNA genes .

What is the structural and functional importance of cytochrome o ubiquinol oxidase subunit 3 (cyoC) in Buchnera aphidicola?

Cytochrome o ubiquinol oxidase subunit 3 (cyoC) is an integral membrane protein component of the respiratory chain in Buchnera aphidicola. As part of the cytochrome o ubiquinol oxidase complex (EC 1.10.3.-), it participates in electron transport and oxidative phosphorylation processes . The protein contains multiple transmembrane domains, as evidenced by its hydrophobic amino acid sequence, which allows it to be embedded in the bacterial membrane .

How does one properly store and handle recombinant Buchnera aphidicola proteins for experimental use?

Proper storage and handling of recombinant Buchnera aphidicola proteins, including cyoC, are essential for maintaining protein integrity and experimental reproducibility. Based on established protocols, the following methodological approach is recommended:

For short-term storage (up to one week), store working aliquots at 4°C to minimize protein degradation while maintaining accessibility . For long-term storage, keep the protein at -20°C, or preferably at -80°C for extended periods . The protein should be stored in an appropriate buffer system, typically a Tris-based buffer with 50% glycerol for subsp. Baizongia pistaciae cyoC or Tris/PBS-based buffer with 6% Trehalose at pH 8.0 for subsp. Acyrthosiphon pisum cyoC .

To minimize protein degradation from repeated freeze-thaw cycles, create small single-use aliquots before freezing . When reconstituting lyophilized protein, briefly centrifuge the vial to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For optimal stability, add glycerol to a final concentration of 5-50% .

What experimental approaches are recommended for studying the functional properties of recombinant cyoC in relation to its role in Buchnera metabolism?

Studying the functional properties of recombinant cyoC requires a multifaceted experimental approach due to the protein's integral membrane nature and its role in energy metabolism. Researchers should consider the following methodological strategy:

First, validate protein folding and integrity through circular dichroism spectroscopy, which is particularly valuable for membrane proteins like cyoC to confirm proper secondary structure formation. Follow this with enzymatic activity assays measuring ubiquinol oxidation rates using purified recombinant cyoC reconstituted in liposomes or nanodiscs to mimic the native membrane environment .

For integration into functional studies of Buchnera metabolism, consider using complementation assays in E. coli cyoC knockout strains, as E. coli is the closest free-living relative to Buchnera . This approach can determine if the recombinant Buchnera cyoC can functionally replace its E. coli counterpart. Additionally, site-directed mutagenesis of conserved residues can identify critical functional domains by assessing how mutations affect enzyme activity.

To investigate protein-protein interactions within the cytochrome o ubiquinol oxidase complex, employ techniques such as blue native PAGE, chemical cross-linking followed by mass spectrometry, or co-immunoprecipitation with other subunits of the complex expressed in the same system.

How can researchers effectively compare cyoC sequence variations across different Buchnera strains and link them to host adaptation?

Effective comparison of cyoC sequence variations across Buchnera strains requires a systematic approach combining bioinformatics, molecular biology, and functional analysis. Researchers should implement the following methodological framework:

Begin with comprehensive sequence alignment of cyoC genes from multiple Buchnera strains associated with different aphid hosts, paying particular attention to GC content, which has been shown to correlate strongly with gene identity when compared to E. coli homologs . For each sequence variant, calculate the percentage GC content and correlate it with conservation levels to predict long-term maintenance in the genome.

Construct phylogenetic trees based on cyoC sequences and compare them with aphid host phylogenies to identify potential co-evolutionary patterns. Special attention should be given to amino acid substitutions in functional domains that might reflect adaptation to different host environments or feeding behaviors .

To experimentally validate the functional significance of identified variations, express recombinant versions of different cyoC variants and compare their enzymatic properties, thermal stability, and interaction with other respiratory chain components. Consider using heterologous expression systems that can accommodate membrane proteins, such as E. coli or yeast expression systems with appropriate tags for purification .

The table below summarizes key differences between cyoC from two Buchnera subspecies that could serve as a starting point for comparative analyses:

FeatureB. aphidicola subsp. Baizongia pistaciae cyoCB. aphidicola subsp. Acyrthosiphon pisum cyoC
Length194 amino acids205 amino acids
UniProt IDQ89AA5P57542
Host aphidBaizongia pistaciaeAcyrthosiphon pisum
First 10 AAMKKKYKIDTNMIENKFNNTI
Expression system reportedNot specifiedE. coli
Tag used in recombinant formDetermined during productionHis-tag (N-terminal)

What are the challenges in designing experiments to investigate the role of cyoC in the aphid-Buchnera symbiotic relationship?

Investigating the role of cyoC in the aphid-Buchnera symbiotic relationship presents several significant challenges due to the obligate nature of the symbiosis and the complex metabolic interactions. Researchers should be aware of these methodological hurdles and consider the following strategies:

The primary challenge is that Buchnera cannot be cultured independently from its aphid host, making direct genetic manipulation extremely difficult . To overcome this, researchers can utilize RNA interference (RNAi) targeting cyoC to reduce its expression within the aphid host. Carefully design siRNAs specific to Buchnera cyoC to avoid off-target effects on aphid genes. Monitor knockdown efficiency using RT-qPCR and assess phenotypic effects on both Buchnera population dynamics and aphid fitness parameters.

Another approach involves comparative metabolomics between aphids harboring different Buchnera strains with natural variations in cyoC. Use high-resolution mass spectrometry to profile metabolite differences, particularly focusing on amino acids and energy metabolism intermediates that might be affected by alterations in respiratory chain function .

When designing experiments, consider that Buchnera cells reside within specialized bacteriocytes, requiring careful microdissection techniques to isolate these cells for analysis. Additionally, the presence of multiple Buchnera strains within a single aphid, as reported in some species, adds complexity to experimental design and interpretation of results . Use strain-specific molecular markers to differentiate between strains when analyzing cyoC function.

How does the PICOT framework apply to designing research studies on Buchnera cyoC protein?

The PICOT framework (Population, Intervention, Comparison, Outcome, and Time) provides a structured approach for designing research studies on Buchnera cyoC protein, especially for experimental investigations. Researchers can apply this framework as follows:

Population: Clearly define the biological system under investigation, such as the specific Buchnera aphidicola subspecies (e.g., subsp. Baizongia pistaciae or Acyrthosiphon pisum), the expression system (e.g., E. coli), and the form of the protein (e.g., full-length with His-tag) . Consider whether you're studying the isolated recombinant protein, the protein in membrane preparations, or its function within intact Buchnera cells.

Intervention: Specify the experimental manipulations, such as site-directed mutagenesis of specific cyoC residues, varying substrate concentrations, altering pH or temperature conditions, or introducing inhibitors of cytochrome o ubiquinol oxidase activity. For studies within the symbiotic context, interventions might include altering the aphid's diet to change available nutrients to Buchnera .

Comparison: Establish appropriate control groups, such as wild-type cyoC protein, homologous proteins from free-living relatives like E. coli, or cyoC variants from different Buchnera subspecies . This comparative approach enables identification of subspecies-specific adaptations or conserved functional elements.

Outcome: Define clear, measurable endpoints, such as enzyme kinetic parameters, protein stability measurements, changes in growth rates, alterations in essential amino acid production, or effects on aphid fitness when the symbiotic relationship is manipulated .

Time: Establish the timeline for measurements, particularly important for studying protein stability, enzyme kinetics over time, or changes in the symbiotic relationship across aphid developmental stages .

By applying this framework, researchers can develop more rigorous and focused studies that address specific questions about cyoC function in both biochemical and ecological contexts.

What methods can be used to investigate the relationship between GC content and functional conservation of cyoC in Buchnera aphidicola?

The investigation of the relationship between GC content and functional conservation of cyoC in Buchnera aphidicola requires a combination of computational and experimental approaches. Based on research showing strong correlation between GC content and gene identity compared to E. coli homologs, the following methodological strategy is recommended:

Experimentally, express recombinant versions of cyoC with modified GC content while maintaining amino acid sequence through codon optimization. Compare the expression levels, folding efficiency, and functional activity of these variants to assess how GC content affects protein production and function independent of amino acid sequence .

To evaluate functional conservation, develop a complementation system in E. coli where the native cyoC is replaced with Buchnera variants. Measure growth rates, respiratory activity, and fitness under different environmental conditions to assess functional equivalence .

The table below illustrates the type of data that should be collected and analyzed:

Buchnera SubspeciescyoC GC Content (%)Identity to E. coli homolog (%)Protein Function RetentionHost Aphid Species
B. aphidicola subsp. Baizongia pistaciae~26% (estimated)[To be determined][Functional assays]Baizongia pistaciae
B. aphidicola subsp. Acyrthosiphon pisum~26% (estimated)[To be determined][Functional assays]Acyrthosiphon pisum
B. aphidicola from Diuraphis noxia~26% (based on genome average)[To be determined][Functional assays]Diuraphis noxia

What are the key considerations when designing expression systems for recombinant Buchnera cyoC protein?

When designing expression systems for recombinant Buchnera cyoC protein, researchers must address several critical factors to ensure successful production of functional protein. The following methodological considerations are essential:

For membrane proteins like cyoC, the expression vector should include appropriate features: an inducible promoter for controlled expression (as overexpression of membrane proteins can be toxic), a fusion tag for detection and purification (such as an N-terminal His-tag as used for Acyrthosiphon pisum cyoC), and potentially a signal sequence for proper membrane targeting .

Expression conditions require careful optimization. Start with lower induction temperatures (16-25°C) to slow protein production and allow proper folding and membrane insertion. Consider using specialized E. coli strains designed for membrane protein expression that have modified membrane composition or additional chaperones .

For purification, employ a two-step strategy, first isolating membrane fractions followed by detergent solubilization of the target protein. Select detergents carefully based on protein stability and downstream applications. For functional studies, consider reconstitution into liposomes or nanodiscs to provide a native-like membrane environment .

How should researchers approach the validation of recombinant cyoC protein quality and functionality?

Validation of recombinant cyoC protein quality and functionality requires a systematic approach combining analytical and functional methods. Researchers should implement the following validation protocol:

Begin with basic protein characterization: SDS-PAGE to confirm molecular weight (approximately 21-22 kDa for cyoC), western blotting with anti-His antibodies (for His-tagged versions) or specific anti-cyoC antibodies, and mass spectrometry to verify the primary sequence and identify any post-translational modifications .

For structural validation, use circular dichroism spectroscopy to assess secondary structure elements, which should show patterns typical of membrane proteins with high alpha-helical content. If resources allow, structural studies using cryo-electron microscopy can provide valuable insights into the protein's membrane topology and association with other subunits of the cytochrome o ubiquinol oxidase complex.

Functional validation is critical and should include enzymatic activity assays measuring ubiquinol oxidation rates. Set up an assay system using artificial electron donors and oxygen consumption measurements. Compare the kinetic parameters (Km, Vmax) of the recombinant protein with those reported for similar enzymes from related bacteria .

For proteins intended for interaction studies, validate binding to known partners (other subunits of the cytochrome complex) using techniques such as co-immunoprecipitation, surface plasmon resonance, or microscale thermophoresis. Thermal shift assays can provide information about protein stability under different buffer conditions, helping optimize storage and experimental parameters .

What are the emerging research questions about cyoC in Buchnera that remain to be addressed?

Several critical research questions about cyoC in Buchnera aphidicola remain unresolved and represent important areas for future investigation. Researchers might consider addressing the following questions:

How does the evolution of cyoC in different Buchnera strains correlate with the feeding habits and host plant specialization of their aphid hosts? This question requires comparative genomic approaches combined with ecological data on host plant preferences .

What is the precise role of cyoC in the metabolic integration between aphid and Buchnera? Specifically, how does respiratory chain function influence the synthesis of essential amino acids that are provided to the host? Metabolic flux analysis using isotope labeling could help elucidate these connections .

Given that multiple Buchnera strains can coexist within a single aphid, as reported for some species, do these strains show variations in cyoC sequence or expression that might reflect functional specialization or complementation? Single-cell approaches for isolating and analyzing individual bacteriocytes could address this question .

How does the extreme GC content bias in Buchnera genomes affect the translation efficiency and folding properties of cyoC, and what mechanisms has Buchnera evolved to maintain functional proteins despite these constraints? Ribosome profiling and protein folding studies could provide insights .

Is there evidence for post-transcriptional regulation of cyoC in Buchnera, possibly through polyadenylation as preliminarily reported? This question requires detailed RNA analysis, including 3'-end sequencing of cyoC transcripts .

How can research on Buchnera cyoC contribute to broader understanding of endosymbiont evolution and host-microbe interactions?

Research on Buchnera cyoC has significant potential to advance our understanding of endosymbiont evolution and host-microbe interactions through several key contributions:

Buchnera aphidicola represents an excellent model for studying genome reduction in obligate endosymbionts. The retention of cyoC despite extensive gene loss indicates its essential function . Comparative studies of cyoC across different Buchnera strains can reveal how essential metabolic functions are maintained while genomes shrink, providing insights into the minimal genetic requirements for cellular life.

The relationship between GC content and gene conservation in Buchnera is particularly relevant to cyoC study. Research has shown that Buchnera protein coding genes tend toward a mean GC content of approximately 26%, which strongly correlates with their identity to E. coli homologs . Understanding how cyoC maintains functionality despite these genomic constraints can illuminate general principles of protein evolution under AT-biased mutation pressure.

The involvement of cyoC in energy metabolism positions it at the interface between host and symbiont metabolic integration. Investigating how cyoC function relates to the production of essential amino acids for the aphid host may reveal mechanisms of metabolic complementation that could apply to other host-symbiont systems .

From an applied perspective, understanding the function of cyoC in the context of aphid-Buchnera interaction may provide novel targets for aphid control strategies, particularly for agricultural pests like Diuraphis noxia (Russian wheat aphid) . Since aphids cannot survive without their Buchnera endosymbionts, targeting components essential for this symbiosis offers a potential avenue for specific pest management that minimizes environmental impact.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.