Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Flagellar biosynthetic protein flhB (flhB)

Shipped with Ice Packs
In Stock

Description

Biological Context of FlhB in Buchnera aphidicola

Buchnera aphidicola subsp. Baizongia pistaciae is an obligate endosymbiont of aphids, maintaining a highly reduced genome (~600 kbp) specialized for nutrient provisioning to its host . Among its retained genes are those encoding flagellar basal body components, including FlhB, a core protein of the type III secretion system (T3SS) . Despite Buchnera’s nonmotile nature, these structures are expressed in high quantities and hypothesized to facilitate protein export critical for symbiosis .

FlhB is a transmembrane protein essential for substrate specificity switching during T3SS-mediated secretion . In Buchnera, FlhB forms part of the hook-basal-body (HBB) complex, which lacks a filament or motility apparatus but retains conserved structural and secretory machinery .

Recombinant FlhB Production and Applications

Recombinant FlhB refers to the protein produced via heterologous expression systems (e.g., E. coli), as Buchnera cannot be cultured outside aphid hosts . The process involves:

  1. Gene Cloning: Amplifying flhB from Buchnera subsp. Baizongia pistaciae genomic DNA.

  2. Vector Design: Insertion into expression plasmids with affinity tags (e.g., His-tag) for purification .

  3. Protein Purification: Using chromatography techniques to isolate functional FlhB .

Research Applications:

  • Symbiosis Mechanism Studies: Investigating FlhB’s role in exporting symbiosis factors (e.g., amino acids or signaling molecules) .

  • Structural Biology: Cryo-EM analysis of the HBB complex to resolve T3SS architecture .

  • Host Interaction Screens: Identifying aphid proteins interacting with FlhB-secreted substrates .

Key Research Findings

  • Functional Retention: FlhB and other T3SS proteins are conserved across Buchnera lineages, despite genome reduction .

  • Transcriptional Regulation: flhB expression correlates with Buchnera population dynamics in aphid hosts, peaking in low-titer symbionts .

  • Evolutionary Insight: FlhB’s retention suggests exaptation of flagellar machinery for non-motility functions, a hallmark of intimate host-microbe coevolution .

Challenges and Future Directions

  • Cultivation Limitations: Requires reliance on recombinant systems or in vivo aphid models .

  • Unresolved Questions:

    • Does FlhB directly interact with aphid host cells?

    • What substrates are exported via this T3SS?

Current efforts focus on linking FlhB activity to aphid fitness metrics, such as fecundity or stress tolerance . Advances in proteomics and CRISPR-based gene editing in aphids may clarify these mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
flhB; bbp_222; Flagellar biosynthetic protein FlhB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Target Names
flhB
Target Protein Sequence
MNHDESEEKTESPTSYRLKISKETGHNRYYRELYSLLILTITLINFWYNQRLILTLLKRI FYLSFTFNNSIFQNDLFLDHNFLMIFQDNLISLLGIIFFPMLIFMFPAMILCCSNFNFKF IKFDINKLNPILGFKNVFSIKSIVDLFKTVLKIVFVSIVVYLFISKYFLKVCFSSNFTFD YILNYSVRTIFLCFLTILIFFIPIIIIDLFWEKYNFYRSLRMTRKEVSDELKNMEGNPRI KSRIRQIMFSISNRRMLSNVSKSDVIVVNPMHYAIAIKYNETNMYAPKILAKGIDELAIK IKKIGNNHSIPTLVSHSLAHVLYYRTEVGEYIPSVLYEAVAEVLAWVWKIRHWKIKGGVF PRTPEKFFIPSELYEKRIKKRG
Uniprot No.

Target Background

Function
Essential for the formation of the rod structure in the basal body of the flagellar apparatus. Together with FliI and FliH, it may constitute the export apparatus of flagellin.
Database Links

KEGG: bab:bbp_222

STRING: 224915.bbp222

Protein Families
Type III secretion exporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and why is it significant in endosymbiotic research?

Buchnera aphidicola is an endosymbiotic bacterium found in aphids, including the pea aphid. It represents one of the most extensively studied obligate endosymbionts due to its highly reduced genome and intimate relationship with its host. B. aphidicola is particularly significant as it lacks many essential genes for independent life and obtains nutrients from its host while providing essential amino acids in return . The symbiosis is estimated to have been established approximately 200 million years ago, making it an excellent model for studying long-term symbiotic relationships and genome reduction in bacteria .

The strain from Baizongia pistaciae (BBp) is especially valuable for comparative genomics as it represents one of the evolutionarily basal branches among modern Buchnera strains, having diverged 80-150 million years ago from the common ancestor of other sequenced strains . This historical divergence allows researchers to track genomic stasis and gene loss patterns across evolutionary time. Unlike laboratory-cultured strains, BBp material must be collected from natural populations, presenting unique challenges and opportunities for studying genetic variation in symbiont populations.

What is the flagellar biosynthetic protein FlhB and what role does it play in bacterial systems?

FlhB is a transmembrane protein that serves as a crucial component of the flagellar type III secretion system (fT3SS) in bacteria. In motile bacteria, FlhB functions as a substrate specificity switch that controls the ordered export of different flagellar proteins during flagellar assembly . This protein contains both transmembrane and cytoplasmic domains, with the cytoplasmic portion undergoing autocleavage that is essential for its function in export specificity switching .

In Buchnera aphidicola, despite the bacterium being nonmotile, the FlhB protein is retained and expressed as part of a partial flagellar system. The presence of FlhB in this reduced-genome organism suggests it serves an alternative but essential function. Research indicates that in Buchnera, FlhB likely contributes to a protein transport system based on modified flagellar components rather than motility itself . The conservation of FlhB in Buchnera, even as many other flagellar genes have been lost through reductive evolution, underscores its biological importance beyond motility functions.

How does the genome organization of flagellar genes in Buchnera compare to other bacteria?

The Buchnera aphidicola genome contains 26 flagellar genes arranged in five operons clustered in three regions of the genome, despite the cells being nonmotile . When compared to well-characterized flagellar systems such as that of Salmonella, the order of Buchnera flagellar genes in operons shows remarkable conservation. This conservation suggests strong selective pressure to maintain these genomic arrangements despite millions of years of separate evolution.

Table 1: Comparison of Selected Flagellar Protein Homology Between Buchnera aphidicola and Salmonella

ProteinFunctionSequence Homology (%)
FlgGRod component75.0
FlhAT3SS core component~40.0
FlhBT3SS core component~40.0
FliIT3SS core component~40.0
FliPT3SS core component~40.0
FliQT3SS core component~40.0
FliRT3SS core component~40.0
FliJChaperone20.8

What are the key structural features of the FlhB protein and how do they relate to function?

The FlhB protein consists of two main domains: an N-terminal transmembrane domain with multiple membrane-spanning segments and a C-terminal cytoplasmic domain (FlhB-C) that is responsible for substrate specificity switching . The cytoplasmic domain undergoes autocleavage at a conserved asparagine-proline site, which is essential for the protein's function. This cleavage results in two subdomains (FlhB-CN and FlhB-CC) that remain associated after cleavage .

Crystal structures of FlhB-C reveal a compact core domain consisting of four β-strands and four α-helices. In some species, such as Shewanella putrefaciens, the FlhB-C domain also contains a proline-rich region (PRR) at the very C-terminus . The PRR exhibits extensive contacts with the core domain of FlhB-C, suggesting it plays a role in stabilizing the protein structure or mediating protein-protein interactions.

The autocleavage site (N269 in S. putrefaciens) is critical for function, as substitution of this residue by alanine prevents cleavage and leads to complete absence of flagellar filaments . This highlights the essential nature of FlhB processing for substrate specificity switching and flagellar assembly.

What is the significance of the Proline-Rich Region (PRR) in FlhB protein function?

The Proline-Rich Region (PRR) at the C-terminus of FlhB is a distinctive structural feature found in beta- and gamma-proteobacteria . Experimental evidence shows that deletion of the PRR (ΔPRR) results in a significant reduction in flagellation, with approximately 31% fewer filaments and 26% fewer hooks compared to wild-type bacteria . This indicates that while the PRR is not absolutely essential for flagellar assembly, it substantially contributes to the efficiency of the process.

The PRR contains multiple proline residues (positions 361, 363, 365, 369, and 371 in S. putrefaciens) that likely confer specific structural properties to this region . Proline residues are known to introduce kinks in protein structures and can restrict conformational flexibility. The extensive contacts between the PRR and the core domain of FlhB-C suggest that the PRR may stabilize the protein's conformation or regulate interactions with other flagellar proteins.

Phylogenetic analysis indicates that the PRR is a primary feature of FlhB proteins specifically in flagellated beta- and gamma-proteobacteria . This taxonomic restriction suggests that the PRR evolved to enhance flagellar assembly in these bacterial lineages, potentially representing an adaptation to specific ecological niches or flagellar requirements.

How do flagellar structures in Buchnera differ from those in motile bacteria?

Buchnera aphidicola possesses hundreds of hook-basal-body (HBB) complexes covering its cell surface, despite being nonmotile . These structures differ significantly from complete flagella in motile bacteria as they lack the filament portion, which is the long external structure responsible for propulsion. The Buchnera genome lacks the genes for flagellin and other proteins necessary for filament formation .

The abundant HBB complexes in Buchnera suggest they serve an alternative function to motility. Research indicates these structures may function as protein transporters, not only for flagellar proteins but potentially for other proteins involved in maintaining the symbiotic relationship with the host aphid . This repurposing of flagellar components for protein secretion represents an evolutionary adaptation that maintains selected components of the flagellar apparatus while eliminating those strictly necessary for motility.

The abundance of these structures on the Buchnera cell surface is remarkable, with hundreds of HBB complexes per cell . This high density suggests a critical role in cellular function, potentially facilitating efficient protein exchange with the host environment. The maintenance of these structures despite genome reduction underscores their importance in the endosymbiotic lifestyle of Buchnera.

What methods can be used to isolate and purify Buchnera aphidicola for FlhB protein studies?

Isolating Buchnera aphidicola presents unique challenges as this bacterium is considered unculturable outside its host . For the subspecies from Baizongia pistaciae, researchers must collect insects from natural populations in the field, specifically from galls on Pistacia trees . The isolation protocol typically involves pooling material from 5-20 galls to obtain sufficient bacterial biomass.

The purification procedure for Buchnera begins with homogenization of aphid tissue followed by differential centrifugation to separate bacterial cells from host material. Protocols typically use density gradient centrifugation with Percoll or similar media to obtain purified bacterial fractions . Following isolation, researchers can extract DNA using commercial genomic DNA isolation kits, though the resulting preparations may contain significant host DNA contamination. In published studies, DNA preparations contained approximately 55% Buchnera DNA .

For protein studies, additional purification steps may be necessary, including immunoprecipitation or affinity chromatography techniques targeting specific epitopes on the FlhB protein. Western blotting using antibodies against conserved regions of FlhB can confirm the presence and quantity of the target protein in preparations. When working with field-collected material, researchers should account for potential genetic heterogeneity, as samples may contain up to 20 distinct bacterial genotypes .

What experimental approaches are effective for studying FlhB protein structure and function?

Several complementary experimental approaches can be employed to study the structure and function of the FlhB protein:

  • X-ray crystallography: This technique has been successfully used to determine the three-dimensional structure of the cytoplasmic domain of FlhB (FlhB-C) . By crystallizing purified FlhB-C and analyzing X-ray diffraction patterns, researchers can resolve structural features such as the proline-rich region (PRR) and identify critical residues involved in protein function.

  • Site-directed mutagenesis: Creating specific mutations in the flhB gene allows researchers to assess the functional importance of individual residues. For example, substituting the autocleavage site residue N269 with alanine prevents FlhB processing and abolishes flagellar assembly . Similarly, deletion of the PRR or substitution of specific residues within this region can reveal their contributions to protein function.

  • Fluorescence microscopy: Using fluorescent staining techniques for flagellar hooks and filaments enables quantitative assessment of flagellation levels in wild-type and mutant strains . This approach can determine the percentage of flagellated cells and identify defects in flagellar assembly associated with specific FlhB mutations.

  • Protein-protein interaction studies: Techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or surface plasmon resonance can identify proteins that interact with FlhB during flagellar assembly. These interactions may differ between Buchnera and motile bacteria, potentially revealing adaptations specific to the endosymbiotic lifestyle.

How can genetic and genomic approaches advance our understanding of FlhB evolution in endosymbionts?

Genetic and genomic approaches offer powerful tools for investigating FlhB evolution in endosymbionts like Buchnera aphidicola:

  • Comparative genomics: Analyzing FlhB sequences across multiple Buchnera strains from different aphid hosts can reveal patterns of selection and conservation. The comparison of three Buchnera strains (from Baizongia pistaciae, Acyrthosiphon pisum, and Schizaphis graminum) has already demonstrated remarkable genomic stasis over 150 million years of evolution , with nearly perfect gene-order conservation.

  • Phylogenetic analysis: Constructing phylogenetic trees based on FlhB sequences from diverse bacterial species can identify evolutionary relationships and detect instances of horizontal gene transfer or convergent evolution. Such analysis has revealed that the PRR is a primary feature of FlhB proteins in flagellated beta- and gamma-proteobacteria .

  • Polymorphism analysis: Field-collected Buchnera samples contain natural genetic variation that can inform evolutionary processes. The genome assembly of B. aphidicola from B. pistaciae revealed approximately 1,200 polymorphic sites across the 618-kb genome . Analysis of these polymorphisms, particularly those affecting the flhB gene, can provide insights into ongoing selection pressures.

  • Ancestral sequence reconstruction: Computational methods can infer the sequence of ancestral FlhB proteins at key evolutionary nodes, such as at the establishment of the aphid-Buchnera symbiosis approximately 200 million years ago. These reconstructed sequences can guide experiments testing how FlhB function may have changed during the transition to an endosymbiotic lifestyle.

How does FlhB regulate substrate specificity switching in the flagellar type III secretion system?

FlhB plays a critical role in regulating substrate specificity switching during flagellar assembly, transitioning from the export of rod- and hook-type substrates to filament-type substrates. This switch occurs when the growing hook reaches its predetermined length . The molecular mechanism involves autocatalytic cleavage of FlhB between an asparagine and proline residue, resulting in two subdomains (FlhB-CN and FlhB-CC) that remain associated after cleavage.

In motile bacteria like Salmonella, this switching depends on interactions between FlhB and FliK, a molecular ruler protein that measures hook length . When the hook reaches the proper length, FliK interacts with the cleaved form of FlhB to trigger the substrate specificity switch. Mutations in the flhB gene can result in polyhooks (abnormally long hooks without filaments) or other defects in flagellar assembly.

For Buchnera aphidicola, which lacks flagellar filaments, the substrate specificity switching function of FlhB may be repurposed for regulating the export of specific symbiosis-related proteins. The conservation of FlhB autocleavage in Buchnera, despite the absence of complete flagellar structures, suggests this mechanism remains important for protein secretion functions unrelated to motility. Advanced research questions might explore how the substrate specificity of Buchnera's FlhB differs from that of motile bacteria and how these differences relate to the endosymbiotic lifestyle.

What are the potential roles of HBB complexes in protein transport for maintaining symbiosis?

The abundant hook-basal-body (HBB) complexes covering the Buchnera cell surface likely serve as protein transporters essential for maintaining the symbiotic relationship with the host aphid . These structures represent a remarkable example of evolutionary repurposing, where components originally evolved for bacterial motility now facilitate host-symbiont interactions.

Several research questions emerge regarding these structures:

  • Secretion targets: What specific proteins are transported through these HBB complexes? Do they include nutrients, signaling molecules, or other factors essential for symbiosis?

  • Directionality: Is transport unidirectional (from bacterium to host) or bidirectional? How is this directionality regulated?

  • Regulation mechanisms: How is protein transport through HBB complexes regulated in response to changing host conditions or bacterial needs?

  • Structural adaptations: What specific structural modifications differentiate Buchnera's HBB complexes from the corresponding structures in motile bacteria?

  • Evolutionary origin: Did the protein transport function evolve before or after the establishment of the aphid-Buchnera symbiosis?

Investigating these questions requires sophisticated approaches, including proteomics to identify transported proteins, cryo-electron microscopy to visualize structural details of the HBB complexes, and comparative genomics to trace evolutionary changes in the flagellar apparatus during the transition to an endosymbiotic lifestyle.

How does the process of genome reduction in Buchnera affect the conservation and function of flagellar genes?

Genome reduction in Buchnera aphidicola offers a fascinating case study in how endosymbiotic bacteria retain certain gene systems while eliminating others. The Buchnera genome has undergone extensive reduction to approximately 618 kb in the B. pistaciae strain , yet it maintains 26 flagellar genes arranged in five operons . This selective conservation suggests strong evolutionary pressure to maintain these genes despite ongoing genome reduction.

Analysis of the three sequenced Buchnera strains indicates that extensive genome reduction predated the synchronous diversification of Buchnera and its aphid hosts, but gene loss continues at a slower rate among extant lineages . The retention of flagellar genes related to the hook-basal-body complex, while eliminating those for the filament, represents a targeted reduction that preserves functionality for protein transport while eliminating components needed only for motility.

The conservation of gene order within flagellar operons, despite millions of years of separate evolution, indicates that the onset of genomic stasis coincided closely with the establishment of the symbiosis with aphids approximately 200 million years ago . This stasis suggests that the current arrangement of flagellar genes is optimal for their function in the endosymbiotic context and that rearrangements would likely be deleterious.

Table 2: Comparison of Genome Sizes and Flagellar Gene Content in Buchnera Strains

Buchnera StrainHost AphidGenome Size (kb)Flagellar GenesReference
BBpBaizongia pistaciae61826
BApAcyrthosiphon pisum64126
BSgSchizaphis graminum63126

What methodological challenges exist in studying unculturable endosymbionts like Buchnera?

Studying unculturable endosymbionts presents several significant methodological challenges:

  • Limited material: Obtaining sufficient bacterial biomass for biochemical and structural studies requires collecting and processing large numbers of host insects. For B. pistaciae specifically, researchers must collect galls from Pistacia trees in the field , which may be seasonally and geographically restricted.

  • Host contamination: Purified bacterial preparations often contain significant host DNA, proteins, or cellular components. In published studies, Buchnera DNA preparations contained only 55% bacterial DNA , requiring additional purification steps or computational approaches to filter out host sequences.

  • Genetic manipulation: The inability to culture Buchnera outside its host severely limits genetic manipulation possibilities. Traditional approaches like gene knockout or complementation studies are extremely challenging, requiring indirect approaches such as RNA interference in the host or analyzing natural genetic variants.

  • Heterogeneity in samples: Field-collected samples contain multiple bacterial genotypes, complicating sequence analysis and protein characterization. Genome assemblies must account for approximately 1,200 polymorphic sites across the 618-kb genome .

Future methodological advances might include developing in vitro culture systems that mimic the intracellular environment, improved micromanipulation techniques for single-cell analyses, or host-mediated genetic manipulation approaches. These developments would significantly enhance our ability to study the molecular biology of these fascinating endosymbionts.

How might advances in structural biology techniques improve our understanding of the Buchnera FlhB protein?

Recent advances in structural biology offer promising approaches for deeper investigation of the Buchnera FlhB protein:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized structural biology by enabling visualization of large macromolecular complexes in near-native states without crystallization. Cryo-EM could reveal the structure of the complete FlhB protein, including its transmembrane domain, and potentially the entire hook-basal-body complex of Buchnera.

  • Integrative structural biology: Combining multiple techniques such as X-ray crystallography, nuclear magnetic resonance (NMR), small-angle X-ray scattering (SAXS), and computational modeling can provide a more comprehensive structural understanding than any single method.

  • Time-resolved structural studies: Emerging techniques allow visualization of protein dynamics and conformational changes over time. For FlhB, this could reveal the structural transitions associated with autocleavage and substrate specificity switching.

  • In situ structural determination: Methods for determining protein structures directly within cells, such as cellular cryo-electron tomography, could reveal how FlhB is arranged within the native context of the Buchnera cell membrane and hook-basal-body complex.

These advanced structural approaches could address key questions about FlhB function, such as how the proline-rich region (PRR) influences protein conformation, how autocleavage alters the protein's structure, and how FlhB interacts with other components of the protein secretion machinery.

What evolutionary hypotheses could explain the retention of partial flagellar systems in nonmotile endosymbionts?

Several evolutionary hypotheses might explain the retention of partial flagellar systems in nonmotile endosymbionts like Buchnera:

Testing these hypotheses will require comparative genomic analyses across diverse endosymbionts, experimental studies of protein secretion through HBB complexes, and evolutionary modeling of gene loss patterns. The striking conservation of flagellar gene order across millions of years suggests that whatever function these genes serve in Buchnera, it is critically important for the symbiotic relationship with aphids.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.