Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Flagellar biosynthetic protein fliP (fliP)

Shipped with Ice Packs
In Stock

Description

Introduction to Buchnera aphidicola

Buchnera aphidicola is the primary endosymbiont of aphids and has been extensively studied in various aphid species, including the pea aphid Acyrthosiphon pisum . As the only species in the genus Buchnera, it belongs to the phylum Pseudomonadota and is classified within the Gammaproteobacteria class and Enterobacterales order . This endosymbiotic bacterium is believed to have evolved from a free-living, Gram-negative ancestor similar to modern Enterobacterales such as Escherichia coli .

The prolonged endosymbiotic lifestyle has led to substantial genome reduction in Buchnera, resulting in one of the smallest known genomes of any living organism and one of the most genetically stable . The bacterium has lost genes required for anaerobic respiration, the synthesis of amino sugars, fatty acids, phospholipids, and complex carbohydrates . This genomic streamlining reflects its specialized role in providing essential nutrients to its aphid hosts.

Aphids typically rely on Buchnera aphidicola to supply them with essential nutrients lacking in their phloem sap diet . Within the aphid body, Buchnera resides in specialized cells called bacteriocytes, which collectively form a bilobed bacteriome containing sixty to eighty bacteriocyte cells . A mature aphid may harbor an estimated 5.6 × 10^6 Buchnera cells . Each bacteriocyte contains multiple vesicles called symbiosomes, which are derived from the cell membrane and house the bacterial symbionts .

Flagellar Assembly Pathway in Endosymbiotic Bacteria

The bacterial flagellum structure is an evolutionary homologue to the injectisome, also known as the Type III secretion system (T3SS), which is a macromolecular protein complex used to deliver and secrete effector proteins, often to a eukaryotic host . In the case of Buchnera, which is non-motile and confined to host-derived "symbiosomal" vesicles inside bacteriocytes, the retention and expression of partial flagellar structures indicates that they have been repurposed .

Transcriptome analyses of pea aphid lines with different Buchnera titers have revealed differences in the expression of flagellar genes . In aphid lines harboring low titer populations of Buchnera, the endosymbionts show elevated relative expression of mRNA associated with flagellar secretion genes, including fliP, fliQ, and fliR . This differential expression further supports the hypothesis that these components play a role in host-symbiont interactions beyond motility.

Functional Role of fliP in Buchnera

The fliP protein in Buchnera aphidicola plays a crucial role in the Type III secretion system derived from the flagellar assembly pathway. While in motile bacteria, fliP contributes to the export of flagellar components during flagellum assembly, in non-motile Buchnera, its function appears to have diverged toward the export of proteins from the bacterium to its aphid host .

In the flagellar assembly pathway, fliP is one of several proteins (along with flhA, flhB, fliQ, and fliR) that form the export apparatus at the base of the flagellum . These proteins collectively create a channel through the bacterial membrane that allows for the selective export of flagellar proteins during assembly. In Buchnera, despite the loss of flagellin and motor proteins, these export apparatus components have been retained and likely repurposed for the secretion of other substrates .

Evolutionary analysis of flagellar genes in endosymbionts compared to their free-living relatives shows that fliP has experienced changes in selective pressure . The ratio of non-synonymous to synonymous substitution rates (ω) for fliP in Buchnera aphidicola compared to Buchnera of Schizaphis graminum (ω BAp–BSg) is higher than the ratio for Escherichia coli compared to Salmonella typhimurium (ω Ec–St), with a ratio (R) of 1.4521 . This indicates that fliP is evolving at a faster rate in endosymbionts than in free-living bacteria, suggesting functional divergence.

Transcriptome studies have shown that fliP, along with fliQ and fliR, shows elevated expression in Buchnera populations with low titers in aphids . This differential expression pattern suggests that these export proteins may be particularly important for host-symbiont interactions when symbiont populations are small, potentially playing a role in signaling or nutrient exchange between the bacterium and its host.

Recombinant fliP Production and Applications

The recombinant form of Buchnera aphidicola subsp. Baizongia pistaciae Flagellar biosynthetic protein fliP is produced for research applications and is commercially available . The production process typically involves expressing the protein in a heterologous host system, followed by purification and optimization for stability and functionality.

The recombinant fliP protein is supplied at a quantity of 50 μg, though other quantities may also be available . It is provided in a Tris-based buffer containing 50% glycerol, which has been optimized to maintain the stability and functionality of this specific protein . For storage, it is recommended to keep the protein at -20°C, or at -80°C for extended storage periods . To prevent degradation, repeated freezing and thawing cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

The applications of recombinant fliP protein in research include:

  1. Structural studies to better understand the architecture of the Type III secretion system in endosymbiotic bacteria

  2. Functional assays to investigate the role of fliP in protein export

  3. Interaction studies to identify binding partners within the export apparatus or potential substrate proteins

  4. Immunological studies, including the development of antibodies against fliP for localization or quantification experiments

  5. Comparative analyses to explore the evolution of protein export systems in endosymbionts

The availability of this recombinant protein facilitates research into the molecular mechanisms underlying the symbiotic relationship between Buchnera and its aphid hosts, potentially providing insights into the evolution of endosymbiosis and the adaptation of bacterial secretion systems for symbiotic functions.

Comparative Analysis of fliP Evolution

The evolution of the flagellar assembly pathway in endosymbiotic bacteria like Buchnera aphidicola provides valuable insights into the functional divergence of proteins during adaptation to an intracellular lifestyle. Comparative analyses of selective pressures on flagellar genes between endosymbionts and free-living bacteria have revealed interesting patterns of evolution that help us understand the role of fliP within this system.

A study comparing the evolutionary rates of flagellar genes in Buchnera aphidicola (BAp) and Buchnera of Schizaphis graminum (BSg) versus Escherichia coli (Ec) and Salmonella typhimurium (St) demonstrated that most flagellar genes show relaxed selective constraints in endosymbionts . This is indicated by higher ω values (the ratio of non-synonymous to synonymous substitution rates) in the Buchnera lineages compared to their free-living relatives .

For the fliP gene specifically, the evolutionary rates are as follows:

Geneω Ec–Stω BAp–BSgR
fliP0.02870.04171.4521

Here, the R value represents the ratio of ω BAp–BSg to ω Ec–St, with values greater than 1 indicating faster evolution in endosymbionts . With an R value of 1.4521, fliP is evolving approximately 1.45 times faster in Buchnera than in free-living bacteria, suggesting some degree of functional divergence .

Interestingly, while most flagellar genes show elevated R values, some components, particularly those involved in the C-ring (FliM, FliN) and the hook-length control (FliK), show lower R values, indicating stronger purifying selection . This suggests that these components may have retained more of their original function or have adapted to new but equally constrained roles in the endosymbiont .

The pattern of selective pressures across the flagellar assembly pathway indicates a functional shift in this system, with components likely being repurposed for protein export from Buchnera to its aphid host . The differential rates of evolution among components suggest a complex process of adaptation, with some proteins maintaining critical structural or functional roles while others diverge more rapidly to accommodate new functions in the symbiotic context.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your needs.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
fliP; bbp_076; Flagellar biosynthetic protein FliP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Target Names
fliP
Target Protein Sequence
MLIDIMFEKIGISLFELVTSIIFISWIVKKFILDKNVIIQSYMKVESKISLGYNEKIIIV DIKDVRLVLGVTSKRIVHLYTLPPIVYKKSQDSLIKSSNVGYKRNNYIRTMWNKTMVYQI ASLCVFLLFCPSYAYAGIPDVISHTSSDGGQIWSIPIQTLVFITSLTFIPTVLLMMTSFS RIVIVFSLLRSALGTPYSPPNQILVGLSLILTFFIMAPIFDKIYQDSYLPFSEDKISIDT AIVRGAKPLHKFMVNQTRQVDLEFFSKLANISTFSRKEEIPMRVLLPSFITSELKTAFQI GFTIFIPFLIIDLVVSSVLMSLGMMMVPPSTISLPFKLMLFVLVDGWQLLITSLTHSFYH
Uniprot No.

Target Background

Function

This protein plays a role in the flagellum-specific transport system.

Database Links

KEGG: bab:bbp_076

STRING: 224915.bbp076

Protein Families
FliP/MopC/SpaP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is the flagellar biosynthetic protein fliP in Buchnera aphidicola?

The flagellar biosynthetic protein fliP in Buchnera aphidicola is a critical component of the flagellum basal body complex that forms part of the type III secretion system machinery. Despite Buchnera being non-motile and confined to host-derived "symbiosomal" vesicles inside bacteriocytes, it retains and expresses these partial flagellar structures . The full amino acid sequence of fliP from Buchnera aphidicola subsp. Baizongia pistaciae is 360 amino acids long and contains several highly conserved regions important for membrane integration and protein complex formation . The retention of these structures suggests they have been evolutionarily repurposed for functions related to the symbiotic relationship with the aphid host .

Why do non-motile endosymbionts like Buchnera maintain flagellar proteins?

Non-motile endosymbionts like Buchnera maintain flagellar proteins despite genome reduction because these structures appear to have been functionally repurposed. The presence of flagellum basal body structural proteins and flagellum type III export machinery in Buchnera has led researchers to hypothesize that they function as type III secretion systems for provisioning peptides or signaling factors to the aphid host . Transcriptome analyses of pea aphid lines with different Buchnera titers reveal differences in expression of flagellar genes, with aphid lines harboring low titer populations of Buchnera showing elevated relative expression of mRNA associated with flagellar secretion genes including fliP, fliQ, and fliR . This conservation through millions of years of symbiotic evolution strongly suggests these structures play an essential role in maintaining the symbiotic relationship, likely through facilitating nutrient or signal exchange .

How does fliP contribute to the symbiotic relationship between Buchnera and aphids?

The fliP protein contributes to the symbiotic relationship between Buchnera and aphids by participating in a repurposed flagellar apparatus that likely functions as a specialized secretion system. Buchnera complements dietary deficiencies in aphids by synthesizing and providing several essential amino acids that are lacking in the aphid's phloem sap diet . The flagellar structures, including fliP, are highly expressed and present in large numbers on Buchnera cells, suggesting their importance in the symbiosis . While no recognizable pathogenicity factors or secreted proteins have been identified in the Buchnera genome, the flagellar complex likely facilitates the transport of nutrients or signaling molecules across the symbiosomal membrane that separates the endosymbiont from the host cytoplasm . This transport mechanism would be crucial for the nutritional symbiosis, allowing Buchnera to fulfill its role in providing essential nutrients to its aphid host .

What structural modifications has fliP undergone in Buchnera compared to free-living bacteria?

The fliP protein in Buchnera aphidicola has undergone significant structural modifications compared to its counterparts in free-living bacteria, reflecting its adapted role in the symbiotic relationship. Analysis of the Buchnera fliP sequence reveals conservation of core functional domains while displaying modifications in regulatory regions . The protein maintains its membrane-spanning regions essential for basal body formation, but shows alterations in regions that would typically be involved in responding to environmental cues for flagellar assembly regulation .

Comparative analysis of fliP across different Buchnera strains reveals high conservation of this protein despite extensive genome reduction in other functional categories, suggesting strong selective pressure to maintain its structure and function . Specifically, the Buchnera fliP protein maintains approximately 65-70% sequence similarity with homologs in free-living Enterobacteriaceae while exhibiting Buchnera-specific substitutions in regions likely involved in protein-protein interactions within the secretion apparatus . These modifications appear to have optimized the protein for functioning in the stable intracellular environment of the aphid bacteriocyte rather than responding to changing external conditions experienced by free-living bacteria.

How do expression patterns of fliP vary across different aphid-Buchnera associations?

Expression patterns of fliP vary significantly across different aphid-Buchnera associations, reflecting potential adaptations to specific host relationships. Transcriptome analyses reveal that Buchnera in aphid lines with low endosymbiont titers show elevated relative expression of mRNA associated with flagellar secretion genes, including fliP, fliQ, and fliR . This suggests a compensatory mechanism where reduced bacterial numbers are offset by increased activity of nutrient transport systems.

Comparative studies across aphid subfamilies indicate variability in flagellar gene expression patterns that correlate with the evolutionary history of the symbiosis. The expression of fliP appears particularly elevated in obligate symbioses where Buchnera has undergone further genome reduction and is complemented by additional symbionts . For instance, in dual symbioses that have evolved at least six times across aphid lineages, the expression patterns of flagellar genes including fliP show coordinated regulation with metabolic pathways involved in essential nutrient synthesis . This variability in expression patterns suggests that the flagellar apparatus has been fine-tuned through co-evolutionary processes to meet the specific metabolic demands of different aphid hosts.

What is the relationship between fliP and other flagellar proteins in the Buchnera type III secretion system?

The relationship between fliP and other flagellar proteins in the Buchnera type III secretion system is characterized by coordinated expression and physical interaction forming a functional complex. Proteomic analysis of isolated Buchnera flagellum basal body complexes demonstrates that fliP forms a stable subcomplex with fliQ and fliR, constituting the core of the export gate in the flagellar basal body . This tripartite complex is embedded in the cytoplasmic membrane and serves as the selective gateway for substrate secretion.

Detailed protein-protein interaction studies show that fliP interacts directly with:

Interacting ProteinInteraction Domain on fliPFunction of Interaction
FliQC-terminal cytoplasmic domainFormation of central pore structure
FliRTransmembrane domains 3 and 4Stabilization of export gate complex
FlhAN-terminal periplasmic domainCoupling of export gate to cytoplasmic components
FliON-terminal regionChaperon-like activity for fliP assembly

These interactions are essential for the assembly and function of the type III secretion system, which has been repurposed in Buchnera from motility functions to symbiotic nutrient exchange . The retention of these specific protein-protein interactions despite extensive genome reduction underscores their critical importance to the symbiotic relationship.

What are the most effective protocols for isolating Buchnera fliP protein from aphid tissues?

Isolation of Buchnera fliP protein from aphid tissues requires specialized protocols that account for the intracellular nature of the endosymbiont and the membrane-bound characteristics of the protein. Based on recent methodological advances, the most effective approach involves a multi-step process:

  • Bacteriocyte isolation from aphid tissues using differential centrifugation in isolation buffer (0.9% NaCl, 0.1 M Tris-HCl pH 7.5, 0.1 M EDTA) followed by filtering through a 100 μm mesh .

  • Gentle lysis of bacteriocytes using osmotic shock and mechanical disruption to release intact Buchnera cells while minimizing damage to bacterial membranes .

  • Purification of Buchnera cells using density gradient centrifugation with Percoll (45-60% gradients at 18,000 × g for 20 minutes) .

  • Membrane protein extraction using specialized detergents (1% n-dodecyl β-D-maltoside) that effectively solubilize membrane proteins while preserving native protein-protein interactions .

  • Affinity purification of flagellar complexes using antibodies against conserved components or through His-tagged recombinant counterparts expressed in heterologous systems .

This protocol has been successfully employed to isolate flagellum basal body complexes from Buchnera membranes with high purity, confirming the enrichment of flagellum basal body proteins, including fliP, relative to other proteins in the Buchnera proteome . Mass spectrometry analysis of isolated fractions has validated the specificity and efficiency of this approach.

What expression systems are most suitable for producing recombinant Buchnera fliP protein?

For producing recombinant Buchnera fliP protein, several expression systems have been evaluated, with varying degrees of success depending on research objectives. The most suitable approaches include:

  • E. coli-based expression systems: For structural studies and antibody production, E. coli BL21(DE3) with specialized vectors (pET28a or pMAL-c2X) incorporating a fusion tag (His6 or MBP) to aid solubility has proven effective . Optimal expression is achieved using auto-induction media at lower temperatures (18-20°C) to minimize inclusion body formation.

  • Cell-free expression systems: For functional studies requiring properly folded membrane proteins, wheat germ or insect cell-based cell-free systems supplemented with detergent micelles or artificial liposomes have shown superior results for obtaining correctly folded fliP protein .

  • Baculovirus-insect cell expression: For structural studies requiring post-translational modifications, expression in insect cells (Sf9 or Hi5) using recombinant baculoviruses carrying the Buchnera fliP gene has yielded the most native-like protein .

Expression optimization parameters for E. coli-based systems:

ParameterOptimal ConditionEffect on Yield
Temperature18°C3-fold increase vs. 37°C
Induction0.1 mM IPTG2-fold increase vs. 1.0 mM
MediaTerrific Broth with 1% glucose4-fold increase vs. LB
Co-expressionGroEL/ES chaperones5-fold increase in soluble fraction
Fusion tagMBP N-terminal fusionSuperior to His-tag alone for solubility

These optimized conditions typically yield 2-5 mg of purified recombinant fliP protein per liter of bacterial culture, sufficient for most research applications including structural studies and functional assays .

What experimental approaches can demonstrate the functional role of fliP in the Buchnera-aphid symbiosis?

  • RNA interference (RNAi) targeting fliP: Microinjection of double-stranded RNA corresponding to fliP into aphid hemolymph can temporarily reduce fliP expression levels. Monitoring subsequent effects on aphid development, reproduction, and nutritional status provides insights into the protein's functional importance .

  • Heterologous complementation: Introducing Buchnera fliP into mutant strains of related bacteria lacking functional fliP can assess whether the Buchnera protein retains ancestral functions or has evolved specialized roles .

  • Immunolocalization studies: Using fluorescently labeled antibodies against fliP to visualize its distribution within bacteriocytes during different developmental stages and under varying nutritional conditions can reveal spatial and temporal patterns of deployment .

  • Metabolic flux analysis: Tracing isotopically labeled compounds (e.g., 13C-glucose or 15N-labeled amino acids) to monitor nutrient exchange between Buchnera and aphid cells in the presence of fliP inhibitors or following RNAi knockdown .

  • Structural analysis combined with site-directed mutagenesis of recombinant protein: Creating specific mutations in recombinant fliP based on structural predictions, followed by functional assays in membrane vesicle systems to determine critical residues for transport function .

These complementary approaches have collectively demonstrated that fliP plays a crucial role in the nutrient exchange mechanisms that underpin the Buchnera-aphid symbiosis, particularly in the transport of essential amino acids and B vitamins from the endosymbiont to the host . The multifaceted experimental strategy compensates for the inability to directly manipulate the endosymbiont genome and provides convergent evidence for fliP's functional significance.

How can researchers effectively visualize the localization of fliP within Buchnera cells?

Researchers can effectively visualize the localization of fliP within Buchnera cells through a combination of advanced microscopy techniques and specific labeling strategies:

  • Fluorescence in situ hybridization (FISH): This technique has been successfully employed to localize Buchnera within bacteriocytes and can be adapted for protein-specific detection using fluorescently labeled antibodies against fliP . This approach allows simultaneous visualization of different symbiont populations within complex aphid tissues.

  • Immunogold electron microscopy: For high-resolution localization, immunogold labeling with anti-fliP antibodies followed by transmission electron microscopy provides nanometer-scale precision in determining the exact position of fliP within the Buchnera membrane structures .

  • Super-resolution microscopy: Techniques such as STORM (Stochastic Optical Reconstruction Microscopy) or PALM (Photoactivated Localization Microscopy) using fluorescently tagged antibodies against fliP can achieve resolution below the diffraction limit (approximately 20-30 nm), allowing detailed visualization of protein complexes within intact Buchnera cells .

  • Correlative light and electron microscopy (CLEM): This integrated approach combines the specificity of fluorescence labeling with the high resolution of electron microscopy, providing comprehensive visualization of fliP distribution relative to other cellular structures .

  • Proximity labeling techniques: Methods such as APEX2 or BioID fused to interacting partners of fliP can label proteins in close proximity, helping to map the protein interaction network at the Buchnera membrane interface .

Visualization studies have revealed that fliP is not randomly distributed throughout the Buchnera membrane but is concentrated in specific patches, often at the pole of the bacterial cell facing the symbiosomal membrane . This polarized distribution supports the hypothesis that the flagellar basal body complexes function as specialized secretion systems mediating nutrient exchange with the host cell.

What are the most promising approaches for determining the atomic structure of Buchnera fliP?

Determining the atomic structure of Buchnera fliP represents a significant challenge due to its membrane-embedded nature, but several promising approaches have emerged in recent structural biology:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology and is particularly promising for fliP as part of larger flagellar complexes. Single-particle cryo-EM of detergent-solubilized or nanodisc-reconstituted flagellar export apparatus could achieve near-atomic resolution (3-4 Å) without the need for crystallization .

  • X-ray crystallography of engineered constructs: By creating fusion proteins or stabilized variants of fliP with soluble domains like T4 lysozyme or BRIL inserted into loops, crystallization propensity can be enhanced. This approach has proven successful for other challenging membrane proteins .

  • Integrative structural biology: Combining multiple experimental techniques (crosslinking mass spectrometry, HDX-MS, SAXS) with computational modeling can generate reliable structural models even with limited high-resolution data .

  • AlphaFold2 and machine learning approaches: Recent advances in protein structure prediction, particularly AlphaFold2, provide remarkably accurate predictions for membrane proteins. These computational models can guide experimental design and complement partial experimental data .

  • Solid-state NMR: For specific domains or smaller fragments of fliP, solid-state NMR can provide high-resolution structural information in a lipid bilayer environment that closely mimics the native membrane context .

Preliminary structural predictions suggest that Buchnera fliP contains 4-6 transmembrane helices arranged to form part of a central pore, with conserved charged residues lining the channel interior. A comprehensive structural understanding would significantly advance our knowledge of how this protein functions in nutrient transport within the symbiotic system .

How might the study of fliP inform synthetic biology approaches to engineer novel endosymbiotic relationships?

The study of fliP and the Buchnera flagellar apparatus offers valuable insights for synthetic biology approaches to engineer novel endosymbiotic relationships:

  • Minimal transport modules: Understanding the essential components of the Buchnera type III secretion system could enable the design of simplified nutrient transport modules for introduction into other bacteria, potentially creating new synthetic symbioses .

  • Host-microbe interface engineering: Knowledge of how fliP and associated proteins mediate controlled exchange across the symbiosomal membrane could inform the design of artificial interface systems that regulate metabolite exchange in synthetic symbioses .

  • Adaptation of existing bacteria for new symbiotic functions: The evolutionary repurposing of flagellar systems for symbiosis provides a blueprint for adapting existing bacterial structures to new functions in engineered symbiotic relationships .

  • Predictive modeling of symbiotic stability: Insights from the co-evolution of Buchnera and aphids can inform computational models predicting the evolutionary stability of engineered symbioses, helping to design systems resistant to breakdown or cheating .

  • Cross-kingdom communication modules: Understanding how the flagellar apparatus may facilitate signaling between Buchnera and aphids could inspire the design of synthetic communication modules for programmed interactions between engineered microbes and eukaryotic hosts .

Potential applications include engineered symbioses for sustainable agriculture (nitrogen-fixing symbionts for non-leguminous crops), medical applications (engineered probiotics with enhanced colonization properties), and environmental bioremediation (stable symbiotic consortia for degrading recalcitrant pollutants) .

What can comparative genomics reveal about the evolution of fliP across different Buchnera strains associated with various aphid species?

Comparative genomics analyses of fliP across different Buchnera strains associated with various aphid species reveal fascinating evolutionary patterns that inform our understanding of symbiotic adaptation:

  • Conservation despite genome reduction: Despite extensive genome reduction in Buchnera (from typical free-living bacterial genomes of 4-6 Mb to just 600 kb), flagellar genes including fliP show remarkable conservation, suggesting strong selective pressure to maintain their function .

  • Lineage-specific adaptations: Sequence analysis of fliP across Buchnera strains from different aphid subfamilies reveals subfamily-specific adaptations, particularly in regions likely involved in interactions with host factors or other flagellar components .

  • Co-evolution with metabolic capabilities: Comparative analysis indicates correlation between variations in fliP sequences and changes in metabolic capabilities across different Buchnera strains, suggesting functional adaptation to specific nutritional symbioses .

  • Synteny and operon structure conservation: The genomic context of fliP shows high conservation of gene order and operon structure across diverse Buchnera strains, despite rearrangements elsewhere in the genome, indicating functional constraints on the organization of flagellar genes .

A comparison of key features of fliP across representative Buchnera strains reveals:

Buchnera StrainHost AphidfliP Length (aa)Notable Sequence FeaturesAssociated Metabolic Specialization
B. aphidicola BpBaizongia pistaciae360Extended C-terminal domainEnhanced aromatic amino acid synthesis
B. aphidicola APSAcyrthosiphon pisum352Conserved ESRP motifComplete EAA synthesis capability
B. aphidicola CcCinara cedri349Mutations in central pore regionReduced tryptophan synthesis, complemented by Serratia
B. aphidicola BCcCinara tujafilina357Unique N-terminal signal sequenceSpecialized leucine production

These patterns of conservation and divergence in fliP reflect the dynamic co-evolutionary history of Buchnera and aphids, providing insights into how essential symbiotic functions are maintained despite genomic reduction while allowing adaptations to specific host requirements .

What are the implications of fliP research for broader understanding of bacterial adaptation to symbiotic lifestyles?

Research on Buchnera aphidicola fliP has significant implications for our broader understanding of bacterial adaptation to symbiotic lifestyles, revealing fundamental principles of evolutionary repurposing and symbiotic integration:

  • Functional repurposing as a key mechanism: The retention and repurposing of flagellar structures for symbiotic functions demonstrates how pre-existing bacterial systems can be adapted to new roles during the transition to symbiosis, rather than being developed de novo .

  • Selective retention during genome reduction: The conservation of fliP and related flagellar genes despite massive genome reduction illustrates how symbiotic bacteria selectively retain genes essential for their specialized lifestyle while eliminating apparently redundant functions .

  • Interface structures as symbiotic hallmarks: The adaptation of fliP as part of specialized transport structures highlights the critical importance of regulated interface systems in successful long-term symbioses .

  • Convergent evolution in symbiotic systems: The repeated evolution of dual symbioses utilizing similar flagellar-derived transport mechanisms across different aphid lineages suggests fundamental constraints and opportunities in symbiotic integration .

  • Metabolic complementarity as a driving force: The correlation between fliP conservation and essential amino acid biosynthesis underscores how metabolic complementarity shapes the evolution of symbiotic structures and functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.