Recombinant Buchnera aphidicola subsp. Baizongia pistaciae NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
nuoA; bbp_143; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Target Names
nuoA
Target Protein Sequence
MLKSSVIAAQYWAFFTFFFIAVSICVFMLSISWILGGRSSSRYKNTPFESGIVPTNTTNM YCSVKFYLVAIYFVLFDVEALYLYAWSVSIVECGWIGFIEALIFILFLLSGLIYLISSKL LVWKSKNNIHVT
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is considered the primary electron acceptor. This process couples redox reactions with proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This conserves redox energy as a proton gradient.

Database Links

KEGG: bab:bbp_143

STRING: 224915.bbp143

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and why is it significant in symbiosis research?

Buchnera aphidicola is an endocellular symbiotic bacterium of aphids that has undergone spectacular evolutionary and genomic changes compared to free-living bacterial relatives. These changes result from strong intergenerational bottlenecks and effectively asexual reproduction, leading to high fixation rates of mildly deleterious destabilizing mutations . The bacterium's primary function appears to be synthesizing essential amino acids lacking in the aphid host's phloem-sap diet . Buchnera aphidicola subsp. Baizongia pistaciae represents a specific strain that has adapted to life within its host, Baizongia pistaciae . This symbiotic relationship has been maintained for hundreds of millions of years despite genetic drift that would predict early demise of the endosymbiont, making it an exceptional model for studying evolutionary stability in obligate symbioses .

What is the function of NADH-quinone oxidoreductase in bacterial systems?

NADH-quinone oxidoreductase (Complex I) serves as the first enzyme complex of the respiratory chain, coupling NADH oxidation to the generation of a proton motive force across the membrane . This enzyme complex facilitates electron transfer from NADH to ubiquinone while simultaneously translocating protons or ions across the membrane to build an electrochemical gradient essential for ATP synthesis . In bacterial systems like E. coli, Complex I consists of 14 subunits, compared to the 40-50 subunits found in eukaryotic mitochondrial enzymes, making it a minimal functional form of this complex . The NADH-quinone oxidoreductase system is crucial for energy metabolism in bacteria, allowing them to generate ATP through oxidative phosphorylation.

What genomic features characterize Buchnera aphidicola subsp. Baizongia pistaciae?

Buchnera aphidicola subsp. Baizongia pistaciae possesses a highly reduced genome of approximately 618,379 base pairs, consisting of a main chromosome (615,980 bp) and a small plasmid pBBp1 (2,399 bp) . The genome contains a total of 560 genes, including 520 protein-coding genes, 38 RNA genes, and 2 pseudogenes . This genomic reduction reflects the bacterium's evolutionary adaptation to an endosymbiotic lifestyle, retaining primarily genes essential for its symbiotic functions while losing those unnecessary in its protected host environment. Among the retained genes are those involved in essential amino acid biosynthesis, such as histidine biosynthesis genes arranged in the order hisGDCBHAFI, similar to the arrangement in E. coli . The retention of these biosynthetic pathways underscores their importance in the symbiotic relationship with the aphid host.

What methodologies are most effective for expressing recombinant Buchnera aphidicola nuoA?

Expression of recombinant Buchnera aphidicola nuoA presents significant challenges due to the bacterium's highly adapted genome and unique codon usage patterns that have evolved through translational selection . For successful expression, researchers should consider the following methodological approaches:

  • Codon optimization: Adapt the nuoA gene sequence to the codon preference of the expression host (e.g., E. coli) while maintaining critical structural elements. This can be achieved using algorithms that optimize codon usage while preserving important mRNA secondary structures.

  • Expression systems: Utilize low-temperature induction systems (16-20°C) with tunable promoters like the T7 promoter with lac operator in E. coli BL21(DE3) strains. The addition of chaperones (GroEL/GroES) can facilitate proper folding of the membrane protein.

  • Fusion partners: Employ solubility-enhancing fusion tags such as thioredoxin, SUMO, or maltose-binding protein, with precision protease cleavage sites for tag removal.

  • Membrane mimetics: For structural and functional studies, consider reconstitution in nanodiscs, liposomes, or detergent micelles appropriate for membrane proteins.

Since Buchnera proteins have been selected for translational robustness against misfolding , careful monitoring of protein quality is essential using techniques such as circular dichroism and size-exclusion chromatography coupled with multi-angle light scattering.

How can researchers analyze nuoA function in the context of the Buchnera-aphid symbiosis?

Analyzing nuoA function within the Buchnera-aphid symbiosis requires innovative approaches that overcome the challenge of studying an unculturable endosymbiont. A comprehensive strategy includes:

  • Transcriptomic analysis: Quantify nuoA expression relative to other nuo genes under different host physiological conditions using RNA-Seq of isolated bacteriocytes. Correlation of expression patterns with metabolic states can provide insights into regulatory mechanisms and functional importance.

  • Metabolic flux analysis: Employ 13C-labeled substrates to trace energy metabolism pathways in intact bacteriocytes, comparing wild-type functioning with potential perturbations of nuoA expression through RNA interference techniques targeted at the host.

  • Comparative genomics: Analyze nuoA sequence conservation across different Buchnera strains and correlate with host adaptation patterns. The Buchnera aphidicola Bp strain, with its 560 genes, provides a baseline for comparison with other lineages to determine evolutionary constraints on nuoA .

  • Heterologous complementation: Express Buchnera nuoA in E. coli nuo mutants to assess functional conservation and potential adaptation to the symbiotic lifestyle, building on methodologies established for analyzing nuo locus functions .

This multi-faceted approach can illuminate the role of nuoA in maintaining energy metabolism within the symbiotic context, particularly important given Buchnera's role in nutrient provisioning to its host .

What is known about the structural and functional differences between Buchnera nuoA and homologous proteins in other bacteria?

Structural and functional comparisons between Buchnera nuoA and homologous proteins reveal evolutionary adaptations specific to endosymbiotic lifestyle:

A comparative biochemical characterization of recombinant Buchnera nuoA with E. coli NuoA would provide direct evidence of functional adaptations, particularly focusing on stability versus catalytic efficiency tradeoffs that may have occurred during symbiotic evolution.

What strategies can be employed to overcome challenges in purifying recombinant Buchnera nuoA protein?

Purification of recombinant Buchnera nuoA presents significant challenges due to its hydrophobic nature as a membrane protein. Researchers should consider these methodological approaches:

  • Detergent screening: Systematic evaluation of detergents for solubilization efficiency and maintenance of native protein conformation is essential. A detergent panel including mild options like n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), and digitonin should be tested with thermal stability assays to identify optimal conditions.

  • Two-phase extraction: For initial enrichment, implement an aqueous two-phase system using polyethylene glycol and dextran to separate membrane proteins while maintaining their native environment.

  • Chromatographic strategy:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tag

    • Intermediate purification: Ion exchange chromatography calibrated to nuoA's theoretical isoelectric point

    • Polishing: Size exclusion chromatography with appropriate detergent in the mobile phase

  • Quality assessment: Employ multi-angle light scattering coupled with size exclusion chromatography to verify monodispersity and proper oligomeric state, complemented by negative-stain electron microscopy to confirm structural integrity.

Researchers should be particularly mindful of translational robustness concerns in Buchnera proteins , implementing rigorous quality control steps to ensure the recombinant protein maintains native folding properties. Each purification batch should undergo functional validation through reconstitution experiments measuring electron transfer activity.

How can researchers investigate the interaction between nuoA and other subunits of NADH-quinone oxidoreductase?

Investigating subunit interactions within the NADH-quinone oxidoreductase complex requires multidisciplinary approaches:

  • Cross-linking mass spectrometry: Employ chemical cross-linkers with different spacer arm lengths followed by LC-MS/MS analysis to map proximity relationships between nuoA and other subunits. Data should be analyzed using specialized software (e.g., xQuest, pLink) to identify interaction interfaces.

  • Co-immunoprecipitation studies: Develop specific antibodies against nuoA or utilize epitope-tagged versions to pull down interaction partners, followed by mass spectrometry identification. Controls must include non-specific IgG pulldowns and validation with reciprocal co-IPs.

  • Förster resonance energy transfer (FRET): Engineer fluorescent protein fusions to nuoA and potential partner subunits to measure proximity in reconstituted systems or heterologous expression models.

  • Molecular dynamics simulations: Construct in silico models based on homology to related bacterial systems, then perform molecular dynamics simulations to predict stable interaction interfaces and conformational changes during the catalytic cycle.

  • Bacterial two-hybrid system: Adapt the adenylate cyclase-based bacterial two-hybrid system to screen for interactions between nuoA and other Nuo subunits in a cellular context.

These complementary approaches would provide a comprehensive map of nuoA's position and interactions within the complex, informing hypotheses about its functional role in electron transport and proton translocation mechanisms similar to those being elucidated in other bacterial systems .

What are the recommended protocols for analyzing the role of nuoA in proton translocation?

Evaluating nuoA's contribution to proton translocation requires specialized biophysical and biochemical approaches:

  • Reconstitution system development:

    • Purify recombinant nuoA and partner subunits using the methods outlined in section 3.1

    • Reconstitute into liposomes with defined lipid composition (typically 70% E. coli polar lipids, 20% phosphatidylcholine, 10% cardiolipin)

    • Verify correct orientation using protease protection assays

  • Proton translocation measurements:

    • Monitor pH changes using pH-sensitive fluorescent dyes such as ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine

    • Quantify proton movements using a stopped-flow apparatus to capture rapid kinetics

    • Establish controls using ionophores (valinomycin, nigericin) to distinguish proton movement from other ion fluxes

  • Site-directed mutagenesis approach:

    • Identify conserved charged residues in nuoA through sequence alignment with homologs

    • Generate systematic alanine substitutions of these residues

    • Evaluate the impact on proton translocation efficiency using the reconstituted system

  • Complementation testing:

    • Express Buchnera nuoA variants in E. coli nuoA deletion strains

    • Assess respiratory chain function through oxygen consumption measurements

    • Correlate functional complementation with proton translocation ability

How should researchers interpret evolutionary rate variations in nuoA compared to other Buchnera genes?

Interpreting evolutionary rate variations in nuoA requires sophisticated comparative genomic approaches and statistical frameworks:

  • Rate variation analysis:

    • Calculate dN/dS ratios (nonsynonymous to synonymous substitution rates) for nuoA across multiple Buchnera lineages

    • Compare these ratios with other respiratory chain components and genome-wide averages

    • Utilize sliding window analysis to identify domains under different selection pressures

  • Interpretation framework:

    • Higher conservation (lower dN/dS) in specific domains suggests functional constraints critical to energy metabolism

    • Elevated conservation compared to genome-wide patterns would indicate stronger selection for translational robustness

    • Correlation of conservation patterns with structural features can reveal functionally critical regions

  • Comparative context:

    • Analyze nuoA evolution specifically in the Buchnera aphidicola Bp (Baizongia pistaciae) lineage relative to other Buchnera strains

    • Consider the genomic context of nuoA within the nuo operon structure, examining potential co-evolution with interacting subunits

    • Compare evolutionary rates with patterns observed in related free-living bacteria as a baseline

Evidence suggests that proteins involved in fundamental cellular processes in Buchnera have been largely shaped by selection for translational robustness rather than adaptive evolution . Therefore, researchers should carefully distinguish between sequence conservation driven by functional necessity versus that resulting from selection against mistranslation-induced misfolding.

What bioinformatic tools and approaches are most appropriate for analyzing nuoA function and interactions?

For comprehensive bioinformatic analysis of Buchnera aphidicola nuoA, researchers should implement a multi-layered analytical approach:

  • Structural prediction pipeline:

    • AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • HADDOCK or ClusPro for molecular docking with other Nuo subunits

    • CAVER or MOLE for identification of potential proton translocation channels

    • MD simulations (GROMACS, NAMD) in membrane environments to assess dynamics

  • Sequence-based functional analysis:

    • ConSurf for evolutionary conservation mapping onto structural models

    • TransMembrane prediction using Hidden Markov Models (TMHMM) for topology analysis

    • SIFT and PolyPhen-2 to predict functional impacts of natural variants

    • Codon adaptation index analysis to assess translational selection

  • Systems biology integration:

    • Flux Balance Analysis incorporating nuoA function into genome-scale metabolic models of the Buchnera-aphid system

    • Protein-protein interaction network prediction using STRING and interolog mapping

    • Gene co-expression network analysis using transcriptomic data from bacteriocytes

  • Comparative genomics:

    • OrthoMCL or OrthoFinder for identification of orthologs across bacterial species

    • PAML for detecting sites under positive or purifying selection

    • Synteny analysis to examine conservation of genetic context using tools like SyMAP or MCScanX

Given Buchnera's reduced genome of 560 genes , these analyses should be interpreted in the context of the organism's minimal metabolic capabilities and essential symbiotic functions, particularly its role in amino acid biosynthesis for the host .

How can researchers reconcile experimental data with the predicted energy requirements in Buchnera-aphid symbiosis?

Reconciling experimental data with theoretical energy requirements in the Buchnera-aphid symbiosis requires an integrated analytical framework:

  • Energy budget modeling:

    • Construct stoichiometric models of ATP production via NADH-quinone oxidoreductase and subsequent oxidative phosphorylation

    • Calculate theoretical ATP yield per glucose equivalent consumed

    • Compare with estimated ATP requirements for essential amino acid biosynthesis functions

  • Multi-omics data integration:

    • Correlate nuoA expression levels (transcriptomics) with metabolite profiles (metabolomics)

    • Quantify protein abundance (proteomics) to assess resource allocation to energy production versus biosynthetic pathways

    • Develop Bayesian network models to identify causal relationships between energy metabolism and amino acid production

  • Flux analysis approaches:

    • Implement 13C metabolic flux analysis to quantify carbon flow through central metabolism

    • Measure oxygen consumption rates in isolated bacteriocytes as proxy for respiratory chain activity

    • Develop constraint-based models that incorporate thermodynamic constraints on reaction directionality

  • Discrepancy resolution framework:

    • When experimental measurements diverge from theoretical predictions, systematically evaluate:
      a) Possible alternative energy generation pathways not accounted for in models
      b) Host contributions to energy economy of the symbiont
      c) Methodological limitations in measuring bacterial metabolism within host cells
      d) Potential energy-conserving adaptations specific to the endosymbiotic lifestyle

This systematic approach enables researchers to contextualize nuoA function within the broader metabolic network of Buchnera, accounting for its adaptations to the intracellular environment and its role in maintaining the symbiotic relationship despite genomic reduction .

What are the main technical obstacles in studying recombinant Buchnera proteins and how can they be overcome?

Research on recombinant Buchnera proteins faces several technical challenges due to the organism's unique evolutionary history and symbiotic lifestyle. Key obstacles and their solutions include:

  • Codon usage bias:

    • Challenge: Buchnera has evolved under selection for translational robustness , resulting in codon usage patterns that may not be compatible with standard expression hosts.

    • Solution: Implement codon optimization algorithms that preserve critical mRNA secondary structures while adapting to the host's tRNA pool. Additionally, co-express rare tRNAs using vectors like pRARE to accommodate Buchnera's codon preferences.

  • Protein instability:

    • Challenge: Buchnera proteins may have evolved stability features dependent on the intracellular environment of bacteriocytes.

    • Solution: Screen multiple buffer compositions mimicking the intracellular environment of bacteriocytes using differential scanning fluorimetry. Include osmolytes like trehalose or glycine betaine that may function as natural stabilizers in the symbiotic context.

  • Membrane protein expression:

    • Challenge: NuoA as a membrane protein is inherently difficult to express in soluble, functional form.

    • Solution: Employ specialized membrane protein expression systems such as C43(DE3) E. coli strains, cell-free expression systems with nanodiscs or lipid bilayers, and controlled rates of protein production through tunable promoters and low-temperature induction.

  • Functional assay development:

    • Challenge: Assessing functionality of isolated nuoA is difficult outside its native complex.

    • Solution: Develop partial complex reconstitution approaches where nuoA is co-expressed with minimal functional partners, then assess electron transfer activities using artificial electron donors/acceptors that interface with accessible redox centers.

  • Limited reference data:

    • Challenge: Buchnera aphidicola Bp has limited experimental data available compared to model organisms.

    • Solution: Establish clear orthology relationships with better-characterized bacterial systems and develop rigorous validation protocols to confirm that observations from heterologous systems accurately reflect native Buchnera protein functions.

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, and biophysics, with careful validation at each step to ensure biological relevance.

How can the results from heterologous expression systems be validated for relevance to native Buchnera biology?

Validating heterologous expression results requires multiple lines of evidence to establish their relevance to native Buchnera biology:

  • Comparative functional analysis:

    • Express both Buchnera nuoA and E. coli nuoA in the same E. coli knockout background

    • Quantify respiratory chain activity recovery through oxygen consumption rate measurements

    • Compare growth rates under various carbon sources requiring different levels of respiratory chain activity

  • Structural validation:

    • Obtain structural data (e.g., cryo-EM, X-ray crystallography) of the recombinant protein

    • Compare with structural predictions based on Buchnera sequence

    • Verify key structural features predicted to be important for function are preserved

  • In situ correlation:

    • Develop fluorescent or immunological probes specific to nuoA

    • Perform localization studies in intact bacteriocytes

    • Correlate subcellular distribution with predictions from heterologous systems

  • Functional complementation gradient:

    • Create chimeric proteins with domains from both Buchnera and model organism homologs

    • Establish which domains are functionally interchangeable and which maintain species-specific properties

    • Use this information to determine which aspects of heterologous expression results most likely reflect native function

  • Multi-system validation:

    • Compare results across different heterologous systems (E. coli, Bacillus subtilis, cell-free)

    • Features consistent across systems are more likely to represent intrinsic properties of the Buchnera protein

    • System-specific variations may indicate contextual factors affecting protein behavior

This comprehensive validation framework helps researchers distinguish between artifacts of heterologous expression and genuine biological properties, increasing confidence in extrapolations to the native Buchnera-aphid system despite the technical limitations in studying this obligate endosymbiont directly .

What are the most promising future directions for research on Buchnera nuoA and related respiratory chain components?

Future research on Buchnera nuoA and the respiratory chain presents several promising directions that could significantly advance our understanding of symbiotic energy metabolism:

These research directions collectively promise to advance not only our understanding of Buchnera aphidicola's unique biology but also broader concepts in symbiosis, minimal cellular systems, and the evolution of energy metabolism.

How does understanding nuoA function contribute to broader questions in symbiosis research?

Research on Buchnera aphidicola nuoA transcends its specific biochemical role, contributing to fundamental questions in symbiosis biology:

  • Metabolic complementarity: Understanding energy metabolism through nuoA function illuminates how Buchnera maintains sufficient energy production despite extreme genome reduction to fuel essential biosynthetic pathways that benefit its host . This demonstrates fundamental principles of metabolic complementarity that underpin successful long-term symbioses.

  • Evolutionary stability: The persistence of functional respiratory complexes including nuoA, despite strong genetic drift and accumulation of mildly deleterious mutations in Buchnera , provides insights into mechanisms that maintain symbiotic stability over evolutionary timescales. Selection for translational robustness appears to be one such mechanism counter-balancing the effects of genetic drift.

  • Transition to organelles: Studying the Buchnera respiratory chain offers parallels to the evolutionary trajectory of mitochondria, potentially revealing mechanisms that operate during the transition from autonomous organisms to integrated cellular components. The comparison between Buchnera's streamlined NADH-quinone oxidoreductase and the more complex mitochondrial Complex I is particularly informative.

  • Genomic reduction consequences: By focusing on a critical energy-generating complex, nuoA research reveals how organisms balance genomic reduction against maintaining essential functions, a central question in understanding the limits of cellular simplification in symbiotic systems.

  • Multi-partner symbiotic networks: In aphid lineages where Buchnera has acquired co-symbionts due to loss of certain functions , understanding how energy metabolism through nuoA functions in these multi-partner systems provides insights into how metabolic networks can be distributed across multiple organisms in symbiotic consortia.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.