Recombinant Buchnera aphidicola subsp. Baizongia pistaciae NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly equipped with blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing your specified tag.
Synonyms
nuoK; bbp_152; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Target Names
nuoK
Target Protein Sequence
MIPLSHGLILAFFLFSLGFVSLVMHKNILFMLISLEIMINSAALALVVVGNYWNQVDGQI MYILILTLGASESSIGLALLIQCYRHFKTLNIDKLSEMNG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this species, ubiquinone is considered the primary electron acceptor for the enzyme. This process couples the redox reaction with proton translocation, whereby for every two electrons transferred, four hydrogen ions are transported across the cytoplasmic membrane. This action conserves the redox energy in a proton gradient.
Database Links

KEGG: bab:bbp_152

STRING: 224915.bbp152

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the genome context of nuoK differ between Buchnera aphidicola subspecies?

Comparative genomic analysis reveals that despite significant divergence times (80-150 million years) between Buchnera strains from different aphid hosts, gene order is remarkably conserved . The nuoK gene exists within a context of extreme genomic stability, which is unusual for bacterial genomes but characteristic of obligate endosymbionts with reduced genomes. The B. pistaciae genome is approximately 618 kb in size, and while it has undergone substantial gene loss compared to free-living relatives, genes essential for energy metabolism including nuoK are retained . Recent research comparing 72 complete Buchnera genomes demonstrates that while sequence divergence is high, gene order remains relatively stable across strains, with the core genome containing approximately 256 genes . This conservation suggests strong selective pressure to maintain respiratory chain components like nuoK despite ongoing genome reduction.

What are the critical residues in nuoK and their functional significance?

Based on structural and mutational studies of homologous proteins, several critical residues have been identified in nuoK that are essential for its function:

ResiduePositionFunctional RoleImpact of Mutation
Glu-36Transmembrane helix 2Proton translocation and electron couplingComplete loss of activity (Ala substitution)
Glu-72Transmembrane helix 3Modulation of proton pumping efficiencyModerate reduction in activity (Ala substitution)
Arg-25/26Cytosolic loopStabilization of proton-pumping pathwayDrastic reduction in proton translocation

These residues are highly conserved across bacterial NDH-1 complexes and their mitochondrial homologs, underscoring their critical importance to the fundamental bioenergetic processes of the cell. The conservation of these residues in B. pistaciae nuoK would be expected given the strong selective pressure on maintaining energy metabolism functionality in an endosymbiont with a highly reduced genome.

What expression systems are most effective for recombinant production of Buchnera aphidicola nuoK?

For the recombinant production of hydrophobic membrane proteins like nuoK from Buchnera aphidicola, E. coli-based expression systems have proven most effective. The methodological approach typically involves:

  • Gene synthesis based on the Buchnera genome sequence, with codon optimization for E. coli expression

  • Cloning into an expression vector containing an N-terminal His-tag for purification

  • Expression in E. coli strains optimized for membrane protein production (e.g., C41(DE3) or C43(DE3))

  • Induction under mild conditions (lower temperatures of 18-25°C and reduced IPTG concentrations)

  • Membrane fraction isolation followed by detergent solubilization

  • Purification via immobilized metal affinity chromatography (IMAC)

The recombinant protein is typically produced in a form compatible with further structural and functional studies. For long-term storage and stability, the purified protein is often formulated in a buffer containing trehalose (approximately 6%) and can be reconstituted from lyophilized form using deionized sterile water with 5–50% glycerol to maintain stability.

How can researchers address the challenges of studying nuoK in an unculturable bacterium?

Studying proteins from unculturable organisms like Buchnera presents significant methodological challenges that require innovative approaches:

  • Environmental sampling strategies: Collection directly from field sources (e.g., aphid galls) is necessary since Buchnera cannot be cultured independently . For B. pistaciae specifically, researchers have collected samples from galls on Pistacia trees in natural populations .

  • DNA isolation protocols: Specialized protocols for bacterial DNA extraction from insect tissues are employed, with quantitative hybridization used to assess bacterial DNA purity (typically aiming for >50% Buchnera DNA) .

  • Shotgun genome sequencing: This approach has proven effective for assembling complete Buchnera genomes from environmental samples. For example, a small-insert library (1.6–2.0 kb) generated by mechanical shearing (sonication) of genomic DNA allowed for successful genome assembly despite starting with a mixed environmental sample .

  • Heterologous expression: Due to the impossibility of directly culturing Buchnera, recombinant techniques using surrogate hosts like E. coli remain the only viable approach for obtaining sufficient quantities of nuoK protein for functional and structural studies.

When working with field-collected samples, researchers should be aware that the resulting genome assembly may reveal intrapopulational variation, as demonstrated in the B. pistaciae genome study which identified approximately 1,200 polymorphic sites .

What bioinformatic approaches are most informative for comparative analysis of nuoK across Buchnera strains?

For comprehensive comparative analysis of nuoK across different Buchnera strains, researchers should employ a multi-faceted bioinformatic approach:

  • Whole genome alignment tools (such as Mauve or Progressive Cactus) to assess synteny and gene order conservation, which is particularly informative given Buchnera's remarkable genomic stability .

  • Selection pressure analysis using dN/dS ratios to identify sites under purifying or positive selection, which can reveal functional constraints on nuoK residues.

  • Protein structure prediction using tools like AlphaFold2, particularly valuable for membrane proteins like nuoK where experimental structures may be challenging to obtain.

  • Phylogenomic approaches incorporating both Buchnera and aphid sequences to investigate coevolutionary patterns. Recent research using 72 complete Buchnera genomes along with host aphid mitochondrial and nuclear sequences demonstrated significant coevolution at individual, species, generic, and tribal levels .

  • Pan-genome analysis to differentiate core genes (like nuoK) from accessory genes. Recent studies have identified a pan-genome of 684 genes with a core genome of 256 genes across Buchnera strains .

These approaches collectively provide insights into both the conservation of nuoK structure and function across evolutionary time and its adaptation to specific aphid host environments.

How does nuoK contribute to the metabolic interdependence between Buchnera and its aphid host?

The nuoK subunit plays a critical role in maintaining the obligate symbiotic relationship between Buchnera aphidicola and its aphid host through its contribution to energy metabolism:

  • ATP production support: As a component of the respiratory chain, nuoK participates in the generation of ATP that powers essential metabolic processes, including the synthesis of amino acids that Buchnera provides to its aphid host .

  • Nutrient exchange interdependence: The energy generated through the respiratory chain containing nuoK enables Buchnera to synthesize essential amino acids that aphids cannot obtain from their phloem sap diet . This metabolic complementation is fundamental to the symbiosis.

  • Evolutionary adaptation: The obligate nature of the relationship is reflected in the retention of respiratory chain components like nuoK despite extensive genome reduction. The nuoK gene has persisted throughout the 160-280 million year coevolutionary history of the symbiosis .

  • Regulatory adaptation: Buchnera has lost many regulatory factors, resulting in the continuous overproduction of amino acids for the host. The constitutive expression of energy generation components like nuoK likely supports this metabolic capacity .

This interdependence is underscored by the fact that a mature aphid may carry an estimated 5.6 × 10^6 Buchnera cells, housed within specialized bacteriocyte cells in a bilobed bacteriome structure that evolved specifically to maintain this symbiosis .

What insights does the evolutionary conservation of nuoK provide about endosymbiont genome reduction?

The evolutionary conservation of nuoK amid dramatic genome reduction in Buchnera provides several key insights about the process of endosymbiont genome evolution:

  • Selective retention of essential functions: Despite having one of the smallest known bacterial genomes (approximately 618 kb in B. pistaciae), Buchnera retains genes critical for energy metabolism like nuoK, indicating their essential nature for maintaining the symbiosis .

  • Two-phase genome reduction model: Comparative genomics suggests that extensive genome reduction occurred early in Buchnera evolution (coinciding with the establishment of the symbiosis approximately 200 million years ago), while subsequent gene loss has continued at a slower rate among extant lineages . The retention of nuoK throughout this process highlights its fundamental importance.

  • Functional constraint despite sequence divergence: While Buchnera exhibits high levels of genomic sequence divergence, the gene order has remained remarkably stable, particularly for essential complexes like the NADH dehydrogenase containing nuoK .

  • Metabolic streamlining: The loss of genes for anaerobic respiration, synthesis of amino sugars, fatty acids, phospholipids, and complex carbohydrates contrasts with the retention of oxidative phosphorylation components like nuoK, indicating prioritization of core energy production functions .

This pattern of evolutionary conservation amid genome reduction provides a window into the essential gene set required for obligate intracellular life and the metabolic functions that cannot be complemented by the host.

How do mutations in critical nuoK residues affect respiratory chain function in Buchnera aphidicola?

Mutations in critical nuoK residues can have profound effects on respiratory chain function, with implications for both Buchnera metabolism and its symbiotic relationship with aphids:

  • Proton translocation disruption: Mutations in key residues like Glu-36 can completely abolish proton translocation activity, which would severely impair ATP synthesis and consequently all ATP-dependent processes in Buchnera.

  • Electron transfer efficiency: Alterations to residues involved in electron coupling, such as Glu-72, can reduce the efficiency of electron transfer from NADH to quinones, resulting in decreased energy capture.

  • Structural integrity effects: Mutations in residues that stabilize the proton-pumping pathway, such as Arg-25/26, can drastically reduce proton translocation by disrupting the structural organization of transmembrane helices.

  • Symbiosis implications: Given the obligate nature of the Buchnera-aphid relationship and the aphid's dependence on Buchnera for essential amino acids, mutations that significantly impair respiratory chain function would likely have detrimental effects on the symbiosis as a whole .

  • Evolutionary constraints: The high conservation of critical residues across bacterial NDH-1 complexes and mitochondrial homologs suggests strong purifying selection against mutations at these positions.

Understanding these structure-function relationships is particularly important given that Buchnera has lost many genes for alternative energy generation pathways, making the respiratory chain containing nuoK even more crucial for cellular energetics .

What methodological approaches can researchers use to study nuoK membrane topology and integration?

Studying the membrane topology and integration of nuoK presents specific challenges due to its hydrophobic nature and the difficulty of working with Buchnera. Researchers can employ several complementary approaches:

  • Computational prediction methods:

    • Hydropathy analysis to identify transmembrane segments

    • Topology prediction algorithms (TMHMM, TOPCONS)

    • Evolutionary coupling analysis to identify residue pairs likely to be in proximity

  • Experimental approaches:

    • Site-directed cysteine scanning mutagenesis coupled with accessibility measurements

    • Epitope insertion and antibody accessibility studies

    • Limited proteolysis of membrane preparations containing recombinant nuoK

    • Substituted cysteine accessibility method (SCAM) to map water-accessible residues

  • Structural biology techniques:

    • Cryo-electron microscopy of reconstituted NDH-1 complexes

    • NMR studies of isolated nuoK in appropriate membrane mimetics

    • X-ray crystallography of purified respiratory complexes containing nuoK

  • Functional validation:

    • Complementation studies using E. coli mutants lacking nuoK

    • Site-directed mutagenesis of conserved residues to validate topology models

    • Electron paramagnetic resonance (EPR) spectroscopy to measure distances between labeled residues

Through these approaches, researchers can develop detailed models of how nuoK integrates into the membrane and participates in proton translocation and electron transfer functions within the respiratory chain complex.

How does the coevolution of Buchnera and aphids influence nuoK sequence and function?

The coevolutionary relationship between Buchnera aphidicola and its aphid hosts has several important implications for nuoK sequence and function:

  • Phylogenetic congruence: Recent comprehensive studies using 72 complete Buchnera genomes alongside host aphid mitochondrial and nuclear sequences have demonstrated significant coevolution between these partners at individual, species, generic, and tribal levels . This suggests that nuoK evolution is influenced by host-specific adaptations.

  • Functional conservation with sequence divergence: Despite high levels of genomic sequence divergence between Buchnera strains from different aphid hosts, the function of essential proteins like nuoK appears conserved, reflecting the fundamental importance of energy metabolism in maintaining the symbiosis .

  • Host-specific adaptation: The specificity of the Buchnera-aphid relationship may drive subtle adaptations in nuoK sequence and regulation to accommodate the particular metabolic demands of different aphid hosts. Research on Rhus gall aphids has demonstrated that while Buchnera genomes are mostly collinear, there can be lineage-specific gene duplications that may affect energy metabolism .

  • Evolutionary rate constraints: The maternal transmission and lack of horizontal gene transfer in Buchnera results in limited opportunities for genetic recombination, potentially leading to accelerated sequence evolution in nuoK while maintaining functional constraints .

This coevolutionary dynamic provides a unique system for studying how protein sequence and function evolve under the constraints of an obligate symbiotic relationship spanning over 160 million years .

What are the implications of studying nuoK for understanding endosymbiont genome evolution?

Research on nuoK offers valuable insights into fundamental processes of endosymbiont genome evolution:

  • Essential gene retention: The conservation of nuoK across Buchnera strains despite extensive genome reduction provides evidence for the minimal gene set required for intracellular life . This has implications for understanding the limits of genome reduction in obligate symbionts.

  • Molecular clock applications: Comparing nuoK sequences across Buchnera strains with known divergence times (80-150 million years between major lineages) can help calibrate molecular clocks for endosymbiont evolution .

  • Adaptive versus neutral evolution: Studying selection pressures on nuoK can help distinguish between adaptive changes related to host specialization and neutral evolution due to genetic drift in small endosymbiont populations .

  • Gene order conservation mechanisms: The remarkable stability in gene order observed in Buchnera genomes, particularly for essential complexes like the NADH dehydrogenase containing nuoK, raises questions about the mechanisms maintaining synteny over evolutionary time .

  • Models for synthetic biology: Understanding the minimal functional requirements for respiratory chain components like nuoK informs efforts to design minimal bacterial genomes for synthetic biology applications .

These insights contribute to our broader understanding of the evolutionary processes shaping obligate intracellular symbionts and the genomic consequences of the transition from free-living to endosymbiotic lifestyles .

How can structural biology approaches advance our understanding of nuoK function in Buchnera?

Structural biology approaches offer powerful tools for elucidating nuoK function despite the challenges of working with membrane proteins from unculturable bacteria:

  • Comparative structural modeling: Leveraging structures of homologous proteins from model organisms can provide insights into Buchnera nuoK structure-function relationships. The critical residues identified in studies of related organisms (Glu-36, Glu-72, Arg-25/26) serve as valuable reference points for such comparisons.

  • Cryo-electron microscopy (cryo-EM): Recent advances in cryo-EM resolution now enable the structural determination of membrane protein complexes like respiratory chain components without crystallization. This approach could reveal how nuoK integrates into the larger NDH-1 complex and participates in proton translocation.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can map solvent-accessible regions of nuoK and identify conformational changes associated with function, providing insights into the dynamic aspects of proton translocation.

  • Single-particle tracking and super-resolution microscopy: These approaches could potentially visualize the distribution and dynamics of fluorescently tagged nuoK within bacteriocytes, offering insights into its localization and function in the native cellular environment.

  • Molecular dynamics simulations: Computational approaches can model how nuoK functions within the membrane environment, particularly the mechanisms of proton translocation through key residues identified in experimental studies.

These structural approaches complement genetic and biochemical studies to provide a comprehensive understanding of how nuoK contributes to energy metabolism in Buchnera and ultimately supports the symbiotic relationship with aphids .

What reconstitution systems are most effective for studying nuoK activity in vitro?

For functional analysis of nuoK activity in vitro, researchers should consider several reconstitution approaches:

  • Proteoliposome reconstitution: The purified recombinant nuoK protein, ideally as part of the complete NDH-1 complex, can be incorporated into liposomes containing appropriate phospholipids to recreate a membrane environment. This system allows for controlled assessment of proton translocation activity using pH-sensitive fluorescent dyes or electrochemical measurements.

  • Nanodiscs: Incorporating nuoK into membrane scaffold protein (MSP)-bounded nanodiscs provides a more native-like membrane environment while maintaining accessibility for functional studies. This approach is particularly valuable for biophysical characterization of the protein.

  • Proton translocation assays: Activity can be measured by monitoring pH changes across membranes using pH-sensitive fluorescent probes (such as ACMA or pyranine) when the reconstituted system is energized with NADH.

  • Electron transfer measurements: Spectrophotometric assays using artificial electron acceptors like ferricyanide can assess the electron transfer function of the NDH-1 complex containing nuoK.

  • Complementation in E. coli nuoK mutants: Expressing Buchnera nuoK in E. coli strains lacking the endogenous nuoK gene provides a system to assess functional complementation through growth and respiration measurements.

When reconstituting the protein, researchers should consider the buffer conditions reported for the recombinant protein: Tris/PBS buffer with 6% trehalose (pH 8.0), with reconstitution using deionized sterile water (0.1–1.0 mg/mL) supplemented with 5–50% glycerol for stability.

How can genetic approaches overcome the limitations of studying an unculturable endosymbiont?

Given the unculturable nature of Buchnera aphidicola, researchers must employ creative genetic approaches to study nuoK function:

  • Heterologous expression systems: E. coli remains the most practical surrogate host for expressing and characterizing Buchnera proteins. For nuoK specifically, expression in E. coli strains optimized for membrane protein production (C41/C43) has proven effective.

  • Genomic analysis of natural variants: Field collection of diverse aphid populations can provide access to natural variation in Buchnera genes. For example, the sequencing of B. pistaciae revealed approximately 1,200 polymorphic sites, potentially including variations in nuoK that could be correlated with functional differences .

  • Comparative genomics approaches: The analysis of nuoK across the 72 complete Buchnera genomes now available can identify conserved and variable regions that may correlate with host-specific adaptations .

  • Whole-genome transplantation: While challenging, the development of methods to replace endogenous Buchnera in bacteriocytes with engineered strains could eventually provide a system for direct genetic manipulation.

  • RNA interference in aphid hosts: Targeting aphid genes that interact with Buchnera can indirectly probe the symbiotic relationship and potentially reveal aspects of nuoK function in the context of host-symbiont metabolic integration.

These approaches collectively help overcome the limitations imposed by Buchnera's obligate intracellular lifestyle and provide insights into nuoK function despite the inability to culture the organism independently .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.