Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Probable intracellular septation protein A (bbp_255)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. You can use this as a reference for your specific needs.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; bbp_255; Membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Target Names
bbp_255
Target Protein Sequence
MKFLLNSIPTISFFIFYKFYDIFIASFSLMIASLFTFIITSILFNSINKHDLINLIFVIV FGFLTLFYHNSSYIKWKVTIIYFLISIVFLINYLFIKNNLLNIIFKNTIQLSKNVWRKLS LFWSIFFLICAVSNTYIILYFSEQTWVTFKIFGLTILTLIAVIINGFYIYFLKSKIIQ
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintaining cell envelope integrity, and membrane homeostasis.
Database Links

KEGG: bab:bbp_255

STRING: 224915.bbp255

Protein Families
YciB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and why is it significant for studying endosymbiotic relationships?

Buchnera aphidicola is the primary endosymbiont of aphids and the only species in the genus Buchnera. It belongs to the Pseudomonadota phylum within the Gammaproteobacteria class and Enterobacterales order . The significance of Buchnera in endosymbiotic research stems from its extraordinarily long association with aphids, which began between 160 million and 280 million years ago and has persisted through maternal transmission and cospeciation . This relationship represents one of the most well-studied endosymbiotic systems, providing insights into the molecular basis of obligate symbiosis.

Methodologically, researchers studying this relationship should begin by isolating bacteriocytes from aphid hosts using microdissection techniques followed by differential centrifugation to separate Buchnera cells. For genomic studies, specialized extraction protocols must account for the unusually small genome (approximately 600 kbps) and unique AT-rich composition of Buchnera DNA . When designing experiments to study this endosymbiont, researchers should carefully consider the environmental conditions that mimic the intracellular habitat within the specialized aphid bacteriocytes.

What are the key structural characteristics of intracellular septation proteins in bacterial endosymbionts?

Intracellular septation proteins like bbp_255 in Buchnera aphidicola share several structural characteristics with homologous proteins found in related bacteria. Based on studies of similar proteins such as ispA in Shigella flexneri, these are typically small (approximately 21 kDa), highly hydrophobic proteins that integrate into the cellular membrane . Their hydrophobic nature suggests multiple transmembrane domains that anchor them within the bacterial cell membrane.

Methodologically, researchers should approach structural analysis through a combination of techniques. Begin with in silico analysis using hydropathy plots and transmembrane prediction algorithms to identify potential membrane-spanning regions. Follow with experimental approaches including membrane protein extraction using detergent solubilization (e.g., n-dodecyl-β-D-maltoside), followed by affinity chromatography for purification. For detailed structural characterization, consider techniques such as circular dichroism spectroscopy to determine secondary structure elements, and if possible, X-ray crystallography or cryo-electron microscopy for high-resolution structural determination. When working with recombinant versions, optimize codon usage for expression systems and introduce affinity tags that minimally affect protein folding and function.

How does the genome of Buchnera aphidicola reflect its endosymbiotic lifestyle?

The genome of Buchnera aphidicola provides a remarkable example of genomic reduction resulting from its endosymbiotic lifestyle. With one of the smallest genomes of any living organism (approximately 600 kbps), Buchnera has undergone substantial gene loss through its long-term association with aphids . The evolutionary process has resulted in the deletion of genes required for anaerobic respiration, synthesis of amino sugars, fatty acids, phospholipids, and complex carbohydrates . Unlike most other Gram-negative bacteria, Buchnera lacks the genes necessary to produce lipopolysaccharides for its outer membrane .

For researchers investigating genomic aspects of Buchnera, methodological approaches should include comparative genomics with free-living relatives such as Escherichia coli to identify retained versus lost gene clusters. Use specialized bioinformatic pipelines designed for AT-rich and reduced genomes to avoid assembly errors. When analyzing gene content, focus on metabolic pathway reconstruction using tools like KEGG or MetaCyc to identify complementary metabolic capabilities between host and symbiont. Design PCR primers that account for the unusual base composition, and consider whole-genome amplification techniques to overcome the challenges of limited bacterial biomass from aphid specimens.

What functional role does the intracellular septation protein A (bbp_255) play in Buchnera cell division within bacteriocytes?

Based on studies of homologous proteins like ispA in Shigella flexneri, the intracellular septation protein A (bbp_255) in Buchnera aphidicola likely plays a crucial role in cell division, particularly in septum formation during binary fission. In Shigella, mutations in ispA result in defective cell division, leading to the formation of long filamentous bacteria lacking septa . Given Buchnera's reduced genome and specialized intracellular lifestyle, bbp_255 may have evolved additional or modified functions specific to its endosymbiotic context.

Methodologically, researchers should approach this question through multiple experimental strategies. First, develop fluorescent protein fusions (if possible) to visualize bbp_255 localization during cell division using confocal microscopy. Consider developing conditional expression systems in model organisms like E. coli to assess functional complementation of division defects. Time-lapse microscopy of Buchnera within bacteriocytes, using membrane-specific dyes to visualize septum formation, can provide insights into the dynamics of division. Protein-protein interaction studies using bacterial two-hybrid systems or co-immunoprecipitation can identify binding partners within the division machinery. Finally, correlate bbp_255 expression levels with Buchnera proliferation rates within bacteriocytes at different stages of aphid development to establish physiological relevance.

How do the flagellum basal body proteins in Buchnera aphidicola relate to the function of intracellular septation proteins?

Intriguingly, despite its reduced genome, Buchnera aphidicola maintains gene clusters coding for flagellum basal body structural proteins and flagellum type III export machinery . These structures have been shown to be highly expressed and present in large numbers on Buchnera cells . The relationship between these flagellar structures and intracellular septation proteins like bbp_255 represents an important research question, as both may be involved in the spatial organization of cellular components during division or in mediating host-symbiont interactions.

For investigating this relationship, researchers should implement a multi-faceted methodological approach. Begin with co-localization studies using fluorescently labeled antibodies against both bbp_255 and flagellar basal body components, visualized through super-resolution microscopy. Perform co-immunoprecipitation experiments to detect potential physical interactions between these protein systems. Develop protocols for isolating intact Buchnera cells from bacteriocytes while preserving membrane structures, followed by membrane fractionation to identify protein complexes containing both septation and flagellar components. Comparative proteomic analysis of these fractions using liquid chromatography-mass spectrometry (LC-MS/MS) can identify co-occurring proteins. The isolation technique described for flagellum basal body complexes from Buchnera membranes can be adapted to investigate potential associations with bbp_255.

What evolutionary adaptations have occurred in the intracellular septation protein of Buchnera compared to its free-living bacterial ancestors?

The evolutionary trajectory of the intracellular septation protein in Buchnera aphidicola likely reflects the bacteria's transition from a free-living lifestyle to an obligate endosymbiont. Buchnera is believed to have had a free-living, Gram-negative ancestor similar to modern Enterobacterales, such as Escherichia coli . Through millions of years of co-evolution with aphids, Buchnera's genome has undergone significant reduction and specialization.

To methodologically investigate these evolutionary adaptations, researchers should implement several approaches. First, conduct comprehensive phylogenetic analysis incorporating homologous septation proteins from diverse bacterial taxa, with special attention to closely related Enterobacterales. Use specialized models accounting for the AT-bias in Buchnera genomes to avoid analytical artifacts. Calculate selection pressures (dN/dS ratios) along branches leading to endosymbiotic lineages to identify signatures of purifying or positive selection. Employ ancestral sequence reconstruction techniques to infer the likely sequence of the septation protein in the free-living ancestor. Express both the reconstructed ancestral and modern Buchnera versions in a model organism to compare functional properties. Finally, use structural modeling and molecular dynamics simulations to identify how sequence changes might impact protein function in the context of endosymbiosis.

What are the optimal conditions for expressing recombinant Buchnera aphidicola intracellular septation protein A (bbp_255)?

Expressing recombinant proteins from obligate endosymbionts like Buchnera aphidicola presents unique challenges due to their unusual codon usage, hydrophobic nature (in the case of membrane proteins like bbp_255), and potential toxicity to expression hosts. Based on experience with similar proteins, the following methodological approach is recommended:

First, optimize the gene sequence for expression by adjusting codon usage to match the preferred codons of your expression system (typically E. coli for bacterial proteins). For this highly hydrophobic protein, consider fusion partners that enhance solubility, such as maltose-binding protein (MBP) or SUMO, with a cleavable linker. Alternatively, develop a membrane-targeted expression system with careful regulation of expression levels.

Expression conditions should be systematically optimized using a factorial design approach:

  • Temperature: Test lower temperatures (16-20°C) to slow protein production and facilitate proper folding

  • Induction: Use titratable induction systems (such as IPTG concentration gradients or rhamnose-inducible promoters)

  • Growth media: Compare standard LB with enriched media containing osmolytes that may stabilize membrane proteins

  • Host strains: Evaluate specialized strains such as C41(DE3) or C43(DE3) designed for membrane protein expression

For protein extraction, develop a protocol using mild detergents (DDM, LDAO, or Fos-choline) that effectively solubilize membrane proteins while maintaining native conformation. Purification should employ affinity chromatography followed by size-exclusion chromatography to isolate properly folded protein.

How can researchers effectively isolate and purify native bbp_255 from Buchnera aphidicola for functional studies?

Isolating native proteins from obligate endosymbionts requires specialized approaches that account for the unique biological context of these organisms. For bbp_255 from Buchnera aphidicola, the following methodological workflow is recommended:

Begin with the isolation of intact Buchnera cells from aphid bacteriocytes using a protocol adapted from Schepers et al. (2021) . Carefully dissect bacteriocytes from aphids under stereomicroscopy, followed by gentle homogenization and filtration through a 5μm filter to remove host cell debris. Purify Buchnera cells using density gradient centrifugation with Percoll.

For membrane protein extraction, use a differential solubilization approach, testing a panel of detergents (starting with n-dodecyl-β-D-maltoside at 1-2%) to selectively extract membrane proteins while preserving native protein complexes. Enrich for bbp_255 using immunoaffinity purification with custom-developed antibodies raised against synthetically produced peptide epitopes unique to bbp_255.

Verify protein identity and purity using western blotting and mass spectrometry. For functional studies, reconstitute the purified protein into liposomes composed of lipids that mimic the native Buchnera membrane composition. This system allows for functional assays such as protein-protein interaction studies, structural analysis, and reconstitution of septation processes in a controlled environment.

What techniques are most effective for characterizing protein-protein interactions involving bbp_255 in the context of Buchnera's reduced proteome?

Characterizing protein-protein interactions for bbp_255 requires approaches tailored to the unique challenges of working with an endosymbiont having a reduced proteome. The following methodological strategy is recommended:

Implement a multi-tiered approach beginning with in silico prediction of potential interaction partners based on genomic context, co-occurrence patterns across Buchnera strains, and structural modeling. These computational predictions should guide the experimental investigation.

For in vitro studies, use pull-down assays with recombinant bbp_255 as bait, exposing it to Buchnera cell lysates followed by mass spectrometry identification of binding partners. Cross-linking mass spectrometry (XL-MS) can capture transient interactions and provide spatial constraints for subsequent structural modeling.

For in vivo approaches, consider chemical cross-linking of intact Buchnera cells followed by immunoprecipitation targeting bbp_255. Alternatively, if genetic manipulation is possible in a model system, implement a bacterial two-hybrid approach using the full complement of predicted Buchnera proteins as potential interaction partners.

Validate key interactions using microscopy-based techniques such as Förster resonance energy transfer (FRET) or proximity ligation assay (PLA), which can detect protein-protein interactions in situ within bacteriocytes.

For data analysis, construct interaction networks integrating all experimental evidence, weighted by confidence scores. Focus particular attention on interactions with other cell division proteins and flagellar basal body components, given the potential functional relationship between these systems in Buchnera.

How should researchers address the challenges of data reproducibility when working with proteins from obligate endosymbionts like Buchnera aphidicola?

The experimental study of proteins from obligate endosymbionts like Buchnera aphidicola presents unique challenges for data reproducibility due to difficulties in standardizing biological material, limited biomass availability, and the absence of genetic manipulation systems. Researchers should implement the following methodological approaches to enhance reproducibility:

First, establish rigorous standards for aphid colony maintenance, controlling for age, diet, and environmental conditions, as these factors can influence Buchnera populations within bacteriocytes. Develop detailed protocols for bacteriocyte isolation with quality control checkpoints to ensure consistent starting material.

For protein studies, implement multiple technical and biological replicates with appropriate statistical power calculations to determine minimum sample sizes. Use spike-in standards at multiple stages of sample processing to normalize for technical variation. Develop and validate antibodies against multiple epitopes of the target protein to confirm specificity in the reduced proteome context.

When analyzing functional data, account for the unique cellular environment of bacteriocytes by developing appropriate control experiments and normalization strategies. Implement blinded analysis where possible, and utilize positive and negative controls specific to endosymbiont biology.

For reporting, adhere to minimum information standards for proteomic experiments, with detailed documentation of all variables that could affect experimental outcomes. Consider establishing a standardized aphid-Buchnera research resource that provides consistent biological material to multiple laboratories to facilitate direct comparison of results.

What statistical approaches are most appropriate for analyzing the evolutionary conservation of septation proteins across diverse Buchnera strains?

When analyzing evolutionary conservation of septation proteins across diverse Buchnera strains, researchers must account for the unique genomic features of these endosymbionts, including AT-richness, accelerated evolutionary rates, and potential convergent evolution. The following methodological framework is recommended:

Begin with sequence alignment using algorithms specifically optimized for highly divergent sequences, such as MAFFT with the E-INS-i strategy. Manually inspect and refine alignments to account for potential sequencing errors common in AT-rich genomes.

For phylogenetic analysis, implement both maximum likelihood (RAxML or IQ-TREE) and Bayesian (MrBayes or BEAST) methods with models that account for heterogeneity in evolutionary rates across sites and lineages. Use mixture models that can accommodate the biased amino acid composition of Buchnera proteins.

To quantify selection pressures, calculate site-specific and branch-specific dN/dS ratios using PAML or HyPhy, with special attention to branches leading to different aphid host specializations. Test explicitly for relaxed selection versus positive selection using likelihood ratio tests between nested models.

For structural conservation analysis, map sequence conservation onto predicted protein structures using ConSurf or similar tools, focusing on functional domains and interaction interfaces. Calculate root-mean-square deviation (RMSD) between predicted structures of different Buchnera strains as a metric of structural conservation.

Implement comparative statistical approaches such as principal component analysis or discriminant analysis to identify patterns of conservation correlated with ecological factors (host species, geographical distribution, etc.). Use phylogenetic comparative methods to account for non-independence due to shared evolutionary history.

How can researchers integrate proteomics, genomics, and microscopy data to develop comprehensive models of bbp_255 function in Buchnera aphidicola?

Developing integrated models of bbp_255 function requires methodological approaches that effectively combine multi-omics and imaging data. The following framework is recommended:

Start with parallel data acquisition streams: (1) high-resolution proteomics using LC-MS/MS to quantify bbp_255 abundance and post-translational modifications across developmental stages; (2) comparative genomics across Buchnera strains to identify conserved genetic contexts and potential co-evolving genes; and (3) super-resolution microscopy to determine subcellular localization during different phases of Buchnera cell division.

For data integration, implement a multi-step process:

  • Standardize data formats and normalize across platforms to allow direct comparisons

  • Develop a temporal framework that aligns proteomic, transcriptomic, and microscopy data points

  • Use correlation networks to identify relationships between bbp_255 abundance/modification and other cellular processes

  • Implement Bayesian network analysis to infer causality from correlative relationships

  • Develop predictive mathematical models of Buchnera cell division incorporating all data types

Validate integrated models by designing targeted experiments that test specific predictions about bbp_255 function. Use perturbation approaches where possible (such as expressing modified versions of bbp_255 in model organisms) to test model robustness.

For visualization and communication of integrated models, develop dynamic representations that incorporate temporal and spatial dimensions, using platforms such as CellPAINT or similar tools that allow stakeholders to interact with the models and explore different scenarios of protein function.

What novel approaches could advance our understanding of the role of bbp_255 in maintaining the Buchnera-aphid symbiosis?

Advancing our understanding of bbp_255's role in the Buchnera-aphid symbiosis requires innovative methodological approaches that overcome the experimental limitations inherent to obligate endosymbionts. The following research strategies are recommended:

Develop RNA interference (RNAi) targeting bbp_255 mRNA that can be delivered to bacteriocytes through microinjection or feeding, allowing temporary knockdown of expression to observe phenotypic effects on Buchnera division and symbiotic function. Complement this with overexpression of modified versions of bbp_255 to identify potential dominant-negative effects.

Implement CRISPR interference (CRISPRi) systems adapted for use in endosymbionts, potentially delivered via engineered aphid gut bacteria that can transfer constructs to Buchnera. This would provide more precise control over gene expression than RNAi approaches.

Develop organoid-like culture systems that mimic the bacteriocyte environment, potentially allowing maintenance of Buchnera outside the aphid host for expanded experimental manipulation. These systems could incorporate microfluidics for precise control of nutrient delivery and environmental conditions.

Apply correlative light and electron microscopy (CLEM) to simultaneously visualize bbp_255 localization and ultrastructural changes during Buchnera cell division within intact bacteriocytes, providing unprecedented insight into protein function in the native context.

Explore the potential for synthetic biology approaches, such as creating minimal bacterial systems that express recombinant bbp_255 along with other essential Buchnera proteins to reconstitute specific cellular processes in a controlled environment.

How might understanding the structure and function of bbp_255 contribute to broader knowledge of bacterial endosymbiosis evolution?

The study of bbp_255 has significant implications for understanding the evolutionary processes underlying bacterial endosymbiosis. Methodologically, researchers should approach this question through the following framework:

Implement comparative evolutionary analysis of septation proteins across diverse symbiotic systems, including Buchnera in different aphid hosts, Wigglesworthia in tsetse flies, and Blochmannia in carpenter ants. This should include both sequence-based phylogenetic analysis and structural prediction to identify convergent or divergent evolutionary patterns.

Develop experimental approaches to test whether changes in bbp_255 correspond to functional adaptations to the endosymbiotic lifestyle. This could involve expressing different evolutionary variants in model systems and assessing their impact on cell division, interaction with host proteins, and other relevant phenotypes.

Implement ancestral sequence reconstruction to experimentally test hypotheses about the evolutionary trajectory of bbp_255 from free-living ancestor to specialized endosymbiont. This could reveal whether functional changes occurred gradually or through major evolutionary transitions.

Use systems biology approaches to model how changes in cell division proteins like bbp_255 might have co-evolved with other aspects of the symbiotic relationship, such as metabolic complementarity and vertical transmission mechanisms.

The findings should be integrated into broader theoretical frameworks of symbiosis evolution, addressing questions such as whether changes in cell division proteins represent adaptation, drift, or consequences of genome reduction, and how these changes contribute to the establishment and maintenance of obligate endosymbiosis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.