Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Riboflavin biosynthesis protein RibD (ribD)
Description
Introduction
Buchnera aphidicola is a genus of Gram-negative bacteria that exist as endosymbionts in aphids, providing them with essential amino acids that are lacking in their phloem sap diet . Different strains of Buchnera have evolved in association with different aphid species . Buchnera aphidicola subsp. Baizongia pistaciae (BBp) is a specific strain found in the aphid Baizongia pistaciae . Within Buchnera, the riboflavin biosynthesis pathway is crucial for producing riboflavin (vitamin B2), a precursor for essential cofactors like flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) . Riboflavin biosynthesis protein RibD (RibD) is an enzyme involved in this pathway . Recombinant RibD refers to the protein produced using recombinant DNA technology, typically in a host organism like E. coli .
Riboflavin Biosynthesis Pathway
The riboflavin biosynthesis pathway involves several enzymes that catalyze the conversion of GTP and ribulose-5-phosphate into riboflavin . In Escherichia spp., the ribA, ribB, ribD, ribH, and ribE genes encode the enzymes responsible for this process . Specifically, RibD functions as a pyrimidine deaminase/reductase .
Buchnera aphidicola subsp. Baizongia pistaciae RibD
In Buchnera aphidicola subsp. Baizongia pistaciae, the RibD protein plays a similar role in riboflavin synthesis. The complete genome sequence of B. aphidicola from Baizongia pistaciae has been determined, aiding in the identification and characterization of genes like ribD . The ribD gene is present in all Buchnera genomes, with only one copy considered per genome in some studies .
Recombinant Production and Characteristics
Recombinant RibD from Buchnera aphidicola subsp. Baizongia pistaciae is produced in expression systems like E. coli to facilitate research and biochemical characterization . Recombinant proteins are often expressed with a His-tag for purification purposes .
Example of a Recombinant RibD Protein Product :
| Feature | Description |
|---|---|
| Species | Buchnera aphidicola subsp. Baizongia pistaciae |
| Source | E. coli |
| Tag | His-tag |
| Protein Length | Full Length (1-165 amino acids for UPF0114 protein in repA1-repA2 intergenic region(bbp_601) Protein) |
| Form | Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C, avoid repeated freeze-thaw cycles |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute in deionized sterile water to 0.1-1.0 mg/mL, add 5-50% glycerol for long-term storage |
| Gene Name | bbp_601 |
| Synonyms | bbp_601; UPF0114 protein in repA1-repA2 intergenic region |
| UniProt ID | Q89B48 |
MEKLIERIIYASRWLMFPVYIGLSLGFILLTLKFFQQIIFVIPKILMMSESGLVLVVLSL
IDISLVGGLLVMVMFSGYENFISKMEIKTDKKKLGWMGTMDVNSIKNKVASSIVAISSVH
SLRLFMDAEKISNDQIMWCVLIHLTFVISAFGMACIDKMSKRGYS
Function and Significance
RibD is essential for riboflavin biosynthesis, which in turn is critical for the production of FMN and FAD . These cofactors are involved in numerous metabolic processes, including redox reactions . In Buchnera, the provision of riboflavin is crucial for the aphid host, as aphids cannot synthesize this vitamin themselves . The study of RibD and other enzymes in the pathway can provide insights into the metabolic dependencies in this symbiotic relationship and potentially reveal targets for disrupting aphid жизнеспособность .
Research Applications
Recombinant RibD proteins are utilized in various research applications, including:
-
Structural studies: Crystallizing RibD to determine its three-dimensional structure and understand its catalytic mechanism .
-
Enzyme kinetics: Assessing the enzyme's activity, substrate specificity, and inhibition patterns .
-
Drug discovery: Identifying compounds that can inhibit RibD, potentially serving as antibacterial agents .
-
Protein interaction studies: Investigating how RibD interacts with other proteins in the riboflavin biosynthesis pathway .
Product Specs
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Target Background
KEGG: bab:bbp_408
STRING: 224915.bbp408
