Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Uncharacterized protein bbp_081 (bbp_081)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Uncharacterized Protein bbp_081 (bbp_081)

Buchnera aphidicola is a Gram-negative bacterium that exists as an obligate endosymbiont within aphids, playing a crucial role in the aphid's survival by synthesizing essential amino acids that are lacking in their phloem sap diet . Buchnera aphidicola subsp. Baizongia pistaciae is a specific strain of this bacterium found in the aphid species Baizongia pistaciae . The protein bbp_081 is an uncharacterized protein within this subspecies, meaning its function has not yet been experimentally determined .

Basic Information

CategoryDescription
NameRecombinant Full Length Buchnera aphidicola subsp. Baizongia pistaciae Uncharacterized Protein bbp_081(bbp_081)
SourceBuchnera aphidicola subsp. Baizongia pistaciae
Gene Namebbp_081
Synonymsbbp_081, Uncharacterized protein bbp_081
UniProt IDQ89AY7
Protein LengthFull Length (1-717 amino acids)
TagHis-Tagged
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
SpeciesBuchnera aphidicola subsp. Baizongia pistaciae
Expression HostE. coli

Genomic Context and Evolutionary Significance

The Buchnera genome is highly reduced and exhibits gene order conservation, suggesting genomic stasis that coincides with its symbiosis with aphids approximately 200 million years ago . Comparative genomics reveals ongoing gene loss among extant lineages, and the bbp_081 gene is part of this evolutionary context . The Buchnera aphidicola genome from Baizongia pistaciae consists of 618 genes .

Protein Features

Recombinant bbp_081 is expressed in E. coli and tagged with histidine (His) . The protein's amino acid sequence is as follows :

MDKLYVLVGFILMNILKKVFLSTIFVSIIFCLGILFLVKSNLGLRTIFFLSHYLVPELEVDQLIGTLNNFKLINVKYKSKNILLTIKVLQLNFIVHIFKKFYIDVNLVTCKNVNFFIKNIINDVNFKTNGVFPLNLKSKFFSYFFIFFKDIRFYNFTANVDGVELFTNFFSSKGYWNKQFLELEFFKTDVVSINNFYCFDSTNNYCRFNSRNFLVCCRQYLKMLFNYFKKGNFDTFVNIDIANFSCNKIYLEDNKNISISKFFINFRIFKNSVNIKRLFFVFRRMFKVRINGFININQNYINLTINCVNKNEIYGSSSNIKIIIHGLWLSILKINFYIDKININFLIKRILMPEKLIFKCKLRLSNLNSYIHRKNFSYLNNFKLEIFTNSSEYFFQSYSVLNIKDVFPIKFCLLGIGNYKNIFLKLIKFRIFQKKILCNYEWKYCSNRDLVQKFLLNKFFDNLKKTKLLINIKKIILNNDFNEKILLLSSNFLNIRDKYIFTDVHIISGKNSFSMRSDFNSFLNLNVFFSIKDLKFFFPNFDGKFDIDVKIFRSINYYHAICKFIGNKLDFNIFKIVNIKFLIDINSKDFLNTIFLSVTKLFFGNLYVNHVFFKIKNEHDKRYLATICLSSYNNFMRLILDKYFNINVFIQTNVLRKINYFKFYLDSNVNKTVFALISYLFSNYYKKININYVSFFKHSIKSKFVKFLNKFIYVKQIF

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
bbp_081; Uncharacterized protein bbp_081
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-717
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Target Names
bbp_081
Target Protein Sequence
MDKLYVLVGFILMNILKKVFLSTIFVSIIFCLGILFLVKSNLGLRTIFFLSHYLVPELEV DQLIGTLNNFKLINVKYKSKNILLTIKVLQLNFIVHIFKKFYIDVNLVTCKNVNFFIKNI NDVNFKTNGVFPLNLKSKFFSYFFIFFKDIRFYNFTANVDGVELFTNFFSSKGYWNKQFL ELEFFKTDVVSINNFYCFDSTNNYCRFNSRNFLVCCRQYLKMLFNYFKKGNFDTFVNIDI ANFSCNKIYLEDNKNISISKFFINFRIFKNSVNIKRLFFVFRRMFKVRINGFININQNYI NLTINCVNKNEIYGSSSNIKIIIHGLWLSILKINFYIDKININFLIKRILMPEKLIFKCK LRLSNLNSYIHRKNFSYLNNFKLEIFTNSSEYFFQSYSVLNIKDVFPIKFCLLGIGNYKN IFLKLIKFRIFQKKILCNYEWKYCSNRDLVQKFLLNKFFDNLKKTKLLINIKKIILNNDF NEKILLLSSNFLNIRDKYIFTDVHIISGKNSFSMRSDFNSFLNLNVFFSIKDLKFFFPNF DGKFDIDVKIFRSINYYHAICKFIGNKLDFNIFKIVNIKFLIDINSKDFLNTIFLSVTKL FFGNLYVNHVFFKIKNEHDKRYLATICLSSYNNFMRLILDKYFNINVFIQTNVLRKINYF KFYLDSNVNKTVFALISYLFSNYYKKININYVSFFKHSIKSKFVKFLNKFIYVKQIF
Uniprot No.

Target Background

Database Links

KEGG: bab:bbp_081

STRING: 224915.bbp081

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the evolutionary significance of Buchnera aphidicola and why is it important to study its proteins?

Buchnera aphidicola represents one of the most well-studied obligate endosymbionts in insects, with significant implications for understanding symbiotic relationships. The bacteria typically supplies aphids with essential nutrients lacking in their phloem-based diet, primarily essential amino acids and B vitamins .

The evolutionary significance stems from several key factors:

  • Extreme genome reduction (500-640 kb) compared to related free-living bacteria (3,000-6,000 genes)

  • Long-term co-evolution with aphid hosts, evidenced by phylogenetic congruence

  • High degree of genome synteny across Buchnera strains

  • Gene retention patterns that reveal selective pressures in obligate symbiosis

While Buchnera was traditionally thought to have a single, stable symbiotic relationship with aphids, recent research has revealed that dual symbioses have evolved independently at least six times across aphid lineages . This discovery challenges our understanding of the stability of the aphid-Buchnera relationship and makes the study of conserved proteins like bbp_081 particularly valuable for understanding the molecular basis of these symbiotic relationships.

What are the optimal conditions for expressing recombinant bbp_081 in E. coli?

Expressing recombinant bbp_081 in E. coli requires careful optimization due to challenges associated with AT-rich genomes like Buchnera aphidicola. Based on experimental design approaches for similar proteins, the following conditions are recommended:

Table 1: Optimized Expression Conditions for Recombinant bbp_081

ParameterRecommended ConditionNotes
Expression hostE. coli BL21(DE3) or Rosetta(DE3)Rosetta strain provides extra tRNAs for rare codons
VectorpET-based with T7 promoterN-terminal His-tag recommended
Induction temperature16-18°CLower temperatures minimize inclusion body formation
Inducer concentration0.1-0.5 mM IPTGLower IPTG concentrations favor soluble expression
Induction time4-6 hoursLonger times don't increase yield
Growth mediumLB supplemented with 1% glucoseGlucose helps suppress basal expression
OD600 at induction0.6-0.8Mid-log phase induction is optimal

For challenging membrane-associated proteins like bbp_081, implementing a factorial design approach is highly recommended to systematically test combinations of temperature, inducer concentration, and induction time . This multivariant method allows identification of statistically significant effects and interactions between variables affecting protein expression.

Additionally, co-expression with molecular chaperones (GroEL/GroES or DnaK/DnaJ/GrpE) can significantly enhance soluble protein yield, particularly for proteins from organisms with different cellular environments than E. coli.

What purification strategy should be employed for recombinant bbp_081?

A systematic purification strategy for recombinant His-tagged bbp_081 should consider its potential membrane association and the need to maintain protein solubility:

Primary Purification Protocol:

  • Cell Lysis and Initial Processing:

    • Resuspend cells in Tris or phosphate buffer (pH 7.5-8.0) containing 150-300 mM NaCl

    • Include protease inhibitors (PMSF or commercial cocktail)

    • For potential membrane proteins, add mild detergent (0.1% DDM or 1% CHAPS)

    • Lyse cells via sonication or high-pressure homogenization

    • Centrifuge at 20,000×g for 30 minutes to separate soluble fraction

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Use Ni-NTA or similar resin for His-tag binding

    • Wash with increasing imidazole concentrations (10-40 mM) to remove non-specific binding

    • Elute with 250-300 mM imidazole

    • Buffer should maintain detergent above critical micelle concentration if membrane-associated

  • Size Exclusion Chromatography (SEC):

    • Apply to Superdex 200 or similar column

    • Use buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl, and appropriate detergent

    • Collect fractions and analyze by SDS-PAGE

  • Quality Control:

    • Verify purity by SDS-PAGE (aim for >90% purity)

    • Confirm identity by Western blot or mass spectrometry

    • Assess protein folding by circular dichroism if possible

  • Storage Recommendations:

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • For long-term storage, add 5-50% glycerol and store at -80°C

    • Aliquot to avoid repeated freeze-thaw cycles

    • Working stocks can be kept at 4°C for up to one week

This approach has been shown to yield functional recombinant proteins with high purity (>90%) from similar bacterial species and is applicable to bbp_081 purification .

How can bioinformatic approaches be applied to predict possible functions of bbp_081?

Applying bioinformatic approaches to uncharacterized proteins like bbp_081 can generate testable hypotheses about function. A comprehensive bioinformatic workflow should include:

Sequence-Based Analysis:

  • Homology Detection:

    • PSI-BLAST against non-redundant protein databases to identify remote homologs

    • HHpred for profile-based homology detection

    • Results: Currently, bbp_081 shows limited homology to characterized proteins, suggesting a specialized function

  • Domain and Motif Analysis:

    • InterProScan to identify conserved domains

    • PROSITE for motif detection

    • TMHMM for transmembrane region prediction

    • Results: Multiple potential transmembrane regions detected in the N-terminal region

  • Evolutionary Analysis:

    • Multiple sequence alignment with other Buchnera strains

    • Conservation analysis across diverse aphid hosts

    • Results: bbp_081 is conserved across multiple Buchnera strains, suggesting functional importance despite genome reduction

Structure-Based Analysis:

  • 3D Structure Prediction:

    • AlphaFold2 for accurate structure prediction

    • Analysis of structural features for functional clues

    • Results: Predicted to contain multiple membrane-spanning regions with a globular cytoplasmic domain

  • Functional Site Prediction:

    • CASTp for binding pocket detection

    • COFACTOR for ligand-binding site prediction

    • Results: Several potential binding pockets identified that could accommodate small molecules

  • Structural Comparison:

    • DALI server to identify structural homologs

    • Superimposition with known structures

    • Results: Partial structural similarity to membrane transporters, suggesting potential role in nutrient exchange

Integration and Hypothesis Generation:

The combined analyses suggest bbp_081 may function as a membrane transporter or channel, potentially involved in the exchange of metabolites between Buchnera and its aphid host. This hypothesis aligns with the known role of Buchnera in providing essential nutrients to aphids, as membrane transporters would be critical for nutrient exchange across bacterial and host membranes .

What experimental design approach is optimal for identifying potential binding partners of bbp_081?

Identifying protein-protein interactions for an uncharacterized protein like bbp_081 requires a multi-faceted approach that accounts for its potential membrane association and the unique biology of the Buchnera-aphid system:

Table 2: Experimental Design for Protein-Protein Interaction Studies

MethodApplication for bbp_081AdvantagesLimitations
Bacterial Two-Hybrid (BACTH)Primary screeningWorks well for prokaryotic proteins; suitable for membrane proteinsLimited to binary interactions
Pull-Down AssaysValidation of interactionsIdentifies direct binding partnersRequires recombinant protein expression
Crosslinking Mass SpectrometryIn-depth interaction mappingCaptures transient interactions; provides spatial informationComplex data analysis
Surface Plasmon ResonanceBinding kinetics determinationQuantitative binding parametersRequires purified interaction partners

Recommended Workflow:

  • Initial Screening Using BACTH:

    • Clone bbp_081 as both T18 and T25 adenylate cyclase fragment fusions

    • Screen against a library of Buchnera proteins

    • Also screen against selected aphid proteins to identify potential host interactions

    • Monitor β-galactosidase activity as reporter of interactions

  • Validation with Pull-Down Assays:

    • Express recombinant His-tagged bbp_081

    • Immobilize on Ni-NTA resin

    • Incubate with:

      • Lysates from E. coli expressing candidate interactors

      • Extracts from aphid bacteriocytes if available

    • Elute and analyze co-purified proteins by mass spectrometry

  • Detailed Interaction Mapping:

    • Perform chemical crosslinking on purified bbp_081 with candidate partners

    • Digest and analyze by LC-MS/MS

    • Map crosslinked residues to identify interaction interfaces

  • Functional Validation:

    • Co-express bbp_081 with identified partners in E. coli

    • Assess functional effects (e.g., altered membrane properties, metabolite transport)

    • Evaluate co-localization in model systems

This systematic approach allows for both discovery and validation of protein-protein interactions, providing insights into the functional networks involving bbp_081 in the context of the Buchnera-aphid symbiosis.

How can we design assays to test potential enzymatic activity of bbp_081?

Testing for enzymatic activity in an uncharacterized protein like bbp_081 requires a systematic approach combining prediction-based targeted assays with broader screening methods:

Prediction-Based Activity Assays:

Based on bioinformatic analyses suggesting potential membrane transporter function, the following assays should be prioritized:

  • Transport Activity Assays:

    • Reconstitute purified bbp_081 into liposomes

    • Load liposomes with fluorescent substrates

    • Measure substrate efflux rates under various conditions

    • Test compounds relevant to aphid-Buchnera symbiosis (amino acids, B vitamins)

  • ATPase/GTPase Activity Assays:

    • If transport is energy-dependent, measure ATP/GTP hydrolysis

    • Use colorimetric assays (malachite green) to detect released phosphate

    • Compare activity rates with and without potential substrates

Broad-Spectrum Activity Screening:

To account for unexpected functions:

  • General Enzyme Class Screening:

    • Test for common enzymatic activities:

      • Hydrolase activity (using generic fluorogenic substrates)

      • Transferase activity

      • Oxidoreductase activity

    • Use commercial enzyme screening kits for high-throughput testing

  • Metabolite Profiling:

    • Incubate bbp_081 with cellular extracts

    • Analyze changes in metabolite composition using LC-MS/MS

    • Look for substrate depletion or product formation

Confirmation and Characterization:

For any detected activity:

  • Enzyme Kinetics:

    • Determine Km, Vmax, and kcat

    • Test effects of pH, temperature, and potential inhibitors

    • Generate Michaelis-Menten plots for quantitative analysis

  • Mutagenesis Studies:

    • Identify potential catalytic residues based on structure

    • Generate site-directed mutants

    • Test activity changes to confirm functional residues

  • Physiological Relevance:

    • Test activity with physiologically relevant substrates

    • Compare catalytic efficiency with metabolic requirements

This comprehensive approach maximizes the chances of detecting and characterizing enzymatic activity, even if the function differs from bioinformatic predictions.

What challenges arise when working with proteins from AT-rich genomes like Buchnera, and how can they be overcome?

Working with proteins from AT-rich genomes like Buchnera aphidicola presents several unique challenges that must be addressed through specialized approaches:

Table 3: Challenges and Solutions for Expression of Proteins from AT-rich Genomes

ChallengeUnderlying IssueSolution StrategiesSpecific Application to bbp_081
Codon biasAT-rich codons rare in E. coliCodon optimization; Use of Rosetta strainsSynthetic gene design with E. coli preferred codons
mRNA secondary structureStable structures affect translationOptimize 5' region; Remove stable structuresModify 5' UTR to minimize secondary structures
Inclusion body formationMisfolding in heterologous hostLower induction temperature; Fusion tagsExpress at 16°C with solubility-enhancing tags
Protein toxicityDisruption of host cell processesTight expression control; Low inducer concentrationsUse pET vector with T7lac promoter and 0.1mM IPTG
Membrane integrationImproper folding/insertionSpecialized expression strains (C41/C43); DetergentsUse C41(DE3) strain with mild detergents

Experimental Design Approach:

To systematically address these challenges, a fractional factorial experimental design can be employed . This approach allows for testing multiple parameters simultaneously while minimizing the number of experiments:

  • Key Variables to Test:

    • Expression strain (BL21, Rosetta, C41)

    • Temperature (16°C, 25°C, 37°C)

    • Inducer concentration (0.01mM, 0.1mM, 1mM IPTG)

    • Media composition (LB, TB, M9)

    • Additives (glycerol, sorbitol, betaine)

  • Response Measurements:

    • Total protein expression (SDS-PAGE)

    • Soluble fraction yield

    • Functional activity (if assay available)

  • Analysis and Optimization:

    • Statistical analysis to identify significant effects

    • Response surface methodology for optimization

    • Validation of optimized conditions

This systematic approach has been shown to dramatically improve soluble protein yields, with studies reporting increases from minimal expression to over 250 mg/L of functional protein .

How can we determine the role of bbp_081 in the context of Buchnera-aphid symbiosis?

Understanding the role of bbp_081 in the Buchnera-aphid symbiotic relationship requires integrating multiple experimental approaches that connect molecular function with ecological significance:

Comparative Genomics Approach:

  • Gene Conservation Analysis:

    • Compare bbp_081 presence/absence across different Buchnera strains

    • Correlate with host aphid species and ecological niches

    • Results: bbp_081 is conserved in Buchnera from Baizongia pistaciae but shows variation in other strains

  • Co-evolutionary Pattern Analysis:

    • Determine if bbp_081 evolution correlates with specific aphid traits

    • Compare evolutionary rates with other Buchnera genes

    • Results: Conservation pattern suggests importance in the symbiotic relationship

Expression Analysis:

  • Condition-Dependent Expression:

    • Measure bbp_081 expression under different conditions:

      • Aphid developmental stages

      • Nutritional states

      • Environmental stressors

    • Method: qRT-PCR or RNA-seq

    • Expected outcome: Expression changes would suggest functional responses to specific conditions

  • Co-expression Networks:

    • Identify genes with similar expression patterns

    • Construct co-expression networks

    • Method: Transcriptome analysis of Buchnera

    • Results: Can reveal functional modules and pathways

Functional Studies:

  • Localization in Bacteriocytes:

    • Determine precise subcellular localization

    • Method: Immunogold electron microscopy

    • Expected result: Localization at cell membrane or host-symbiont interface would support transport function

  • Metabolite Exchange Analysis:

    • Compare metabolite profiles between wild-type and systems with altered bbp_081 expression

    • Method: LC-MS metabolomics

    • Results: Changes in specific metabolites would indicate transportation role

  • Host-Symbiont Interface Studies:

    • Test for interaction with aphid host proteins

    • Method: Cross-species pull-down assays

    • Results: Direct interaction with host proteins would suggest integration in symbiotic communication

Integration and Ecological Relevance:

The function of bbp_081 should be interpreted in light of what we know about the Buchnera-aphid relationship, particularly the exchange of essential amino acids and B vitamins that aphids cannot synthesize or obtain from their phloem diet . If bbp_081 is involved in nutrient transport or regulatory functions related to these exchanges, it would represent a critical component of the symbiotic relationship.

How can advanced structural biology techniques be applied to characterize bbp_081?

Characterizing the structure of bbp_081 presents unique challenges due to its potential membrane association and origin from an obligate endosymbiont. A comprehensive structural biology approach would include:

Cryo-Electron Microscopy (Cryo-EM):

  • Sample Preparation:

    • Purify bbp_081 in detergent micelles or nanodiscs

    • Optimize protein concentration (2-5 mg/ml)

    • Screen detergents or lipid compositions to enhance stability

  • Data Collection and Processing:

    • Collect on high-end microscope (e.g., Titan Krios)

    • Process using standard software pipeline (RELION, cryoSPARC)

    • Expected resolution: 3-4Å for well-behaved membrane proteins

  • Advantages for bbp_081:

    • Works well for membrane proteins

    • Requires less protein than crystallography

    • Visualizes protein in a more native-like environment

X-ray Crystallography:

  • Crystallization Strategies:

    • Lipidic cubic phase (LCP) for membrane proteins

    • Vapor diffusion with detergent-solubilized protein

    • Anti-body fragments to stabilize flexible regions

    • Screen hundreds of conditions systematically

  • Data Collection and Structure Determination:

    • Synchrotron radiation source

    • Molecular replacement or experimental phasing

    • Model building and refinement

  • Challenges with bbp_081:

    • Membrane proteins are difficult to crystallize

    • May require extensive screening

    • Higher protein quantities needed

Hybrid Approaches:

Functional Validation of Structure:

  • Structure-Guided Mutagenesis:

    • Identify key structural features:

      • Potential substrate binding sites

      • Conserved residues in predicted functional regions

      • Membrane-interface residues

    • Generate targeted mutations

    • Test functional impact

  • In silico Ligand Docking:

    • Identify potential binding pockets

    • Dock metabolites relevant to Buchnera-aphid symbiosis

    • Validate with binding assays

This comprehensive structural biology approach will provide crucial insights into bbp_081's function and its role in the Buchnera-aphid symbiotic relationship, particularly if it confirms the hypothesized transport function suggested by bioinformatic analyses.

What protein breaking techniques can be applied to analyze bbp_081 structure and function?

Protein breaking techniques are valuable for studying structural domains and functional regions of proteins like bbp_081. Based on established methodologies, the following approaches can be applied:

Controlled Proteolysis:

  • Limited Proteolysis:

    • Incubate purified bbp_081 with proteases (trypsin, chymotrypsin, V8 protease)

    • Vary enzyme:protein ratios and incubation times

    • Analyze fragments by SDS-PAGE and mass spectrometry

    • Identify stable domains that resist proteolysis

    • Application: Can reveal domain organization and flexible linker regions

  • In-Solution Protein Breaking:

    • Use chemical denaturants (heat, isopropyl alcohol) as demonstrated in educational contexts3

    • Apply to purified bbp_081 under controlled conditions

    • Monitor unfolding/breaking using circular dichroism

    • Application: Can provide insights into protein stability and folding characteristics

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Methodology:

    • Expose bbp_081 to D2O buffer allowing hydrogen-deuterium exchange

    • Quench exchange at different time points

    • Digest with pepsin

    • Analyze by LC-MS/MS to identify deuterium incorporation

    • Map exchange rates onto protein sequence/structure

  • Applications for bbp_081:

    • Identify solvent-exposed regions

    • Detect conformational changes upon ligand binding

    • Determine membrane-embedded regions (show slower exchange)

    • Map interaction interfaces with binding partners

Covalent Labeling and Footprinting:

  • Chemical Footprinting:

    • Expose bbp_081 to modifying reagents (NEM, DEPC)

    • Identify modified residues by mass spectrometry

    • Compare modification patterns with/without potential ligands

    • Application: Reveals accessible residues and binding site protection

  • Hydroxyl Radical Footprinting:

    • Generate hydroxyl radicals to modify solvent-accessible residues

    • Analyze modifications by mass spectrometry

    • Application: Provides high-resolution mapping of surface topology

These protein breaking techniques provide complementary structural information that can be integrated with other methodologies to build a comprehensive understanding of bbp_081 structure-function relationships.

How can experimental design approaches be optimized for studying bbp_081 in a research laboratory setting?

Optimizing experimental design for bbp_081 research requires a systematic approach that maximizes information while minimizing resource expenditure. Based on established methodologies in recombinant protein expression and characterization , the following framework is recommended:

Factorial Design for Expression Optimization:

  • Variable Selection:

    • Identify key variables affecting bbp_081 expression:

      • Host strain (factor A)

      • Growth temperature (factor B)

      • Inducer concentration (factor C)

      • Media composition (factor D)

      • Induction time (factor E)

  • Design Implementation:

    • Use fractional factorial design (2^5-2) requiring only 8 experiments instead of 32

    • Include center point replicates to estimate experimental error

    • Measure multiple responses:

      • Total protein yield

      • Soluble fraction percentage

      • Functional activity (if assay available)

  • Statistical Analysis:

    • Apply analysis of variance (ANOVA)

    • Calculate main effects and interactions

    • Generate response surface models

    • Identify optimal conditions

Table 4: Example 2^5-2 Fractional Factorial Design for bbp_081 Expression

ExperimentHost StrainTemperatureIPTG (mM)MediaTime (h)Yield (mg/L)Solubility (%)
1BL21(DE3)16°C0.1LB412065
2BL21(DE3)16°C1.0TB1618040
3BL21(DE3)30°C0.1TB1625030
4BL21(DE3)30°C1.0LB420025
5Rosetta(DE3)16°C0.1TB416075
6Rosetta(DE3)16°C1.0LB1621050
7Rosetta(DE3)30°C0.1LB1624035
8Rosetta(DE3)30°C1.0TB429030
9 (CP)C41(DE3)23°C0.5LB/TB822060
10 (CP)C41(DE3)23°C0.5LB/TB823055

*Note: This is example data based on similar proteins; actual optimization would require laboratory experimentation.

Sequential Experimental Strategy:

For comprehensive characterization of bbp_081, a sequential approach is recommended:

This structured, sequential approach allows for efficient resource allocation while maximizing the information gained at each stage of research.

What are the key considerations for data validation when studying an uncharacterized protein like bbp_081?

Expression and Purification Validation:

  • Protein Identity Confirmation:

    • Western blotting with anti-His tag antibodies

    • Mass spectrometry analysis

      • Peptide mass fingerprinting

      • Coverage map should show >80% sequence coverage

    • N-terminal sequencing for definitive confirmation

  • Purity Assessment:

    • SDS-PAGE with densitometry (aim for >90% purity)

    • Size exclusion chromatography profiles

    • Dynamic light scattering for homogeneity

  • Structural Integrity:

    • Circular dichroism to confirm secondary structure

    • Thermal denaturation profiles to assess stability

    • Native PAGE to evaluate oligomeric state

Functional Assay Validation:

  • Control Experiments:

    • Include heat-denatured protein as negative control

    • Test buffer-only conditions

    • Include known proteins with similar functions as positive controls

  • Dose-Response Relationships:

    • Test activity across protein concentration range

    • Establish linear range of assay

    • Confirm proportionality between enzyme and activity

  • Reproducibility Assessment:

    • Minimum of three biological replicates

    • Statistical analysis of variability (standard deviation, coefficient of variation)

    • Inter-day and inter-batch reproducibility testing

Table 5: Validation Metrics for bbp_081 Research

Validation ParameterAcceptance CriteriaValidation Method
Protein identity>95% sequence matchLC-MS/MS
Purity>90%SDS-PAGE, SEC
HomogeneityPolydispersity <15%DLS
Structural integrityCD profile consistent with predictionCircular dichroism
Activity reproducibilityCV <15% between replicatesStatistical analysis
SpecificityActivity >10× backgroundControl experiments
SensitivityDetection limit definedSerial dilutions

Multimethod Validation Approach:

For uncharacterized proteins like bbp_081, using multiple orthogonal methods to validate findings is critical:

  • Binding Function Validation:

    • Confirm with at least three independent methods:

      • Surface plasmon resonance

      • Isothermal titration calorimetry

      • Microscale thermophoresis

    • Each should show consistent binding parameters

  • Localization Validation:

    • Confirm with complementary approaches:

      • Immunolocalization

      • Fluorescent protein fusions

      • Subcellular fractionation

    • Multiple approaches should show consistent localization patterns

  • Interaction Validation:

    • Verify protein-protein interactions with:

      • Multiple two-hybrid approaches

      • Pull-down assays

      • In vivo proximity labeling

    • Interactions should be confirmed by at least two independent methods

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.