Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction

Buchnera aphidicola is an obligate bacterial endosymbiont that has established a mutualistic relationship with aphids, providing essential nutrients to its host . This symbiotic relationship serves as a valuable model for studying mutual symbiotic interactions and the resulting co-evolution between species . Due to its obligate intracellular lifestyle, Buchnera has experienced significant genome reduction, retaining only genes critical for survival and maintaining the symbiotic relationship . This evolutionary adaptation makes the study of remaining functional genes, such as those encoding Undecaprenyl-diphosphatase (uppP), particularly significant.

Undecaprenyl-diphosphatase, classified under EC number 3.6.1.27, is an integral membrane protein that plays a crucial role in bacterial cell wall biosynthesis . The enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate (C55-PP) to undecaprenyl phosphate (C55-P), which serves as an essential carrier lipid in peptidoglycan synthesis . This reaction is vital for bacteria as it enables the recycling of lipid carriers required for transporting cell wall precursors across the cytoplasmic membrane.

In Buchnera aphidicola subsp. Baizongia pistaciae, the uppP protein holds particular interest due to its retention despite extensive genome reduction, suggesting its critical importance for the bacterium's survival and symbiotic function. The recombinant form of this protein has been produced to facilitate biochemical and structural studies, providing valuable tools for understanding bacterial cell wall synthesis mechanisms and host-symbiont interactions.

Biochemical Function

The primary biochemical function of Undecaprenyl-diphosphatase (uppP) is to catalyze the dephosphorylation of undecaprenyl pyrophosphate (C55-PP) to undecaprenyl phosphate (C55-P) . This reaction represents a critical step in bacterial cell wall synthesis, particularly in the recycling pathway of the lipid carrier that transports peptidoglycan precursors across the bacterial membrane.

The enzymatic mechanism involves the hydrolysis of the terminal phosphate bond in undecaprenyl pyrophosphate. This reaction requires magnesium ions (Mg²⁺) as a cofactor, which help coordinate the interaction between the enzyme's active site and the pyrophosphate moiety of the substrate . The conserved glutamate residues within the (E/Q)XXXE motif play a crucial role in this interaction, possibly by coordinating the magnesium ion or directly participating in the hydrolysis reaction .

Table 2: Biochemical Properties and Enzymatic Activity of Recombinant Buchnera aphidicola UppP

PropertyDescription
Catalytic ReactionDephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate
EC Number3.6.1.27
Cofactor RequirementMagnesium ions (Mg²⁺)
Optimal pH RangeNeutral to slightly alkaline (pH 7.0-8.0)
Substrate SpecificityPrimary: Undecaprenyl pyrophosphate; In vitro: Farnesyl pyrophosphate
Alternative NamesBacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase
Kinetic ParametersMutations E17A/E21A affect Km and kcat values

Research indicates that uppP activity is optimal at neutral to slightly alkaline pH values (approximately pH 7.0-8.0) and depends significantly on the presence of divalent cations, particularly magnesium . The enzyme demonstrates specificity for its natural substrate, undecaprenyl pyrophosphate, though it can also utilize farnesyl pyrophosphate (Fpp) as a substrate in laboratory assays .

Beyond its primary role in cell wall synthesis, uppP contributes to bacitracin resistance in bacteria . Bacitracin is an antibiotic that binds to undecaprenyl pyrophosphate, preventing its dephosphorylation and thereby inhibiting cell wall synthesis. By efficiently dephosphorylating undecaprenyl pyrophosphate, uppP can counteract bacitracin's action, contributing to antibiotic resistance mechanisms .

The retention of this enzyme in Buchnera aphidicola, despite extensive genome reduction, underscores its critical importance for the bacterium's survival within its aphid host. The enzyme likely plays an essential role in maintaining bacterial cell envelope integrity, which is necessary for the symbiotic lifestyle of Buchnera within aphid cells and the ongoing mutualistic relationship between these organisms.

Expression and Purification

The production of recombinant Buchnera aphidicola subsp. Baizongia pistaciae Undecaprenyl-diphosphatase (uppP) involves specific expression systems and purification protocols designed to optimize yield and maintain protein functionality. As an integral membrane protein, uppP presents particular challenges for expression and purification, requiring specialized techniques to ensure proper folding and activity.

The expression of recombinant uppP typically utilizes Escherichia coli as the host organism, specifically strains optimized for membrane protein expression . The gene encoding uppP is cloned into appropriate expression vectors, which are then transformed into E. coli for protein production. Based on protocols for similar membrane proteins, expression is induced when bacterial cultures reach appropriate density, commonly using isopropyl β-D-thiogalactoside (IPTG) as the inducing agent .

Table 3: Expression and Purification Parameters for Recombinant Buchnera aphidicola UppP

ParameterSpecification
Expression SystemE. coli
Protein QuantityTypically 50 μg per preparation
Purity Level>85% as assessed by SDS-PAGE
Storage BufferTris-based buffer with 50% glycerol
Storage Temperature-20°C for short-term; -80°C for extended storage
Shelf Life6 months (liquid form) or 12 months (lyophilized form)
ReconstitutionIn deionized sterile water to 0.1-1.0 mg/mL
Working Storage4°C for up to one week

Following expression, the bacterial cells are harvested, and the membrane fraction containing recombinant uppP is isolated through differential centrifugation. The membrane-bound protein is then solubilized using detergents, which extract the protein while maintaining its native conformation . The solubilized protein undergoes purification using affinity chromatography, taking advantage of affinity tags incorporated during the cloning process . The specific tag type is determined during production to optimize protein yield and purity .

Quality assessment of the purified recombinant protein typically involves SDS-PAGE analysis, which confirms a purity level exceeding 85% . Functional assays measuring the enzyme's ability to dephosphorylate substrates verify that the purified protein retains its enzymatic activity .

For optimal stability, the purified recombinant uppP is stored in a Tris-based buffer containing 50% glycerol . The recommended storage conditions include keeping the protein at -20°C for short-term storage or -80°C for extended storage . To preserve enzymatic activity, repeated freezing and thawing should be avoided . For ongoing experiments, working aliquots may be stored at 4°C for up to one week .

Commercial suppliers may offer the protein in different formulations, including lyophilized forms, which provide extended shelf life compared to liquid preparations . Proper reconstitution of lyophilized protein involves brief centrifugation of the vial before opening, followed by addition of deionized sterile water to achieve the desired concentration .

Applications in Research

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Undecaprenyl-diphosphatase (uppP) serves as a valuable research tool across multiple scientific disciplines, offering insights into bacterial physiology, symbiotic relationships, and potential applications in biotechnology and agriculture.

One significant research application involves investigating the molecular mechanisms underlying the aphid-Buchnera symbiotic relationship. Buchnera aphidicola provides essential nutrients to its aphid host, and understanding the function of key proteins like uppP can illuminate how this obligate endosymbiont maintains its cellular processes within the host environment . Studies have shown that host plants can influence Buchnera population sizes in aphids, suggesting complex interactions between the plant, aphid, and bacterial endosymbiont . The availability of recombinant uppP facilitates investigations into how these environmental factors affect enzyme expression and activity.

Table 4: Research Applications of Recombinant Buchnera aphidicola UppP

Application AreaDescription and Significance
Symbiosis ResearchInvestigation of molecular mechanisms in aphid-Buchnera relationships
Structural BiologyAnalysis of membrane protein structure and active site organization
Antimicrobial DevelopmentIdentification of inhibitors targeting bacterial cell wall synthesis
Enzyme KineticsCharacterization of catalytic properties and substrate specificity
Evolutionary BiologyComparative analysis with homologous enzymes from other bacteria
Agricultural ResearchPotential target for managing aphid populations in crops

The recombinant protein enables detailed structural biology studies, which can elucidate the three-dimensional organization of this membrane-bound enzyme. Understanding the structural basis of uppP function provides insights into membrane protein biology and can guide the development of selective inhibitors. The conserved motifs identified in uppP, such as the (E/Q)XXXE and PGXSRSXXT sequences, represent particular points of interest for structural analysis .

In enzyme kinetics research, recombinant uppP allows for detailed characterization of catalytic properties, including substrate specificity, reaction rates, and the effects of potential inhibitors. These investigations can determine kinetic parameters such as Km and kcat values for various substrates and assess how mutations in critical residues affect enzyme function . Such studies contribute to our fundamental understanding of enzyme catalysis in membrane-bound phosphatases.

The role of uppP in bacterial cell wall synthesis makes it a potential target for antimicrobial development. By designing compounds that selectively inhibit uppP activity, researchers may develop novel strategies to disrupt bacterial cell wall formation . Given the specificity of the Buchnera-aphid relationship, such inhibitors could potentially target agricultural pests without broadly affecting beneficial microorganisms.

Recent advances in gene manipulation techniques for unculturable intracellular symbionts, such as the use of peptide nucleic acids (PNAs) to interfere with gene expression in Buchnera, provide new approaches for studying uppP function in vivo . These techniques could allow researchers to directly assess the impact of uppP activity on Buchnera survival and its symbiotic relationship with aphids, offering unprecedented insights into the biological role of this enzyme.

Future Research Directions

The study of Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Undecaprenyl-diphosphatase (uppP) opens numerous avenues for future research across multiple scientific disciplines. Several promising directions warrant further investigation to enhance our understanding of this enzyme's structure, function, and potential applications.

Structural determination represents a significant research priority. While the general features of uppP have been described, high-resolution structures obtained through X-ray crystallography or cryo-electron microscopy would provide invaluable insights into the precise arrangement of the active site and the conformational changes occurring during catalysis . Such detailed structural information would enhance our understanding of the enzyme's mechanism and facilitate structure-based approaches to inhibitor design.

Table 6: Promising Future Research Directions for Buchnera aphidicola UppP

Research DirectionPotential Approaches and Significance
High-Resolution Structure DeterminationX-ray crystallography or cryo-EM to elucidate precise active site organization
Host-Plant Influence StudiesInvestigation of how plant chemistry affects uppP expression and activity in the aphid-Buchnera system
Comparative Evolutionary AnalysisExamination of uppP adaptations in obligate symbionts versus free-living bacteria
Targeted Gene ManipulationApplication of peptide nucleic acids (PNAs) to study uppP function in vivo
Selective Inhibitor DevelopmentDesign of compounds targeting uppP for potential agricultural applications
Molecular Adaptation MechanismsInvestigation of how uppP functions despite genome reduction in Buchnera

The relationship between host plants and Buchnera activity presents another intriguing research direction. Studies have demonstrated that host plants can significantly influence Buchnera population sizes in aphids , but the specific effects on uppP expression and activity remain unexplored. Investigating how environmental factors, including host plant chemistry, affect uppP function could provide insights into the molecular adaptations enabling this obligate symbiosis to persist across diverse ecological conditions.

Recent advances in genetic manipulation techniques for unculturable symbionts offer exciting opportunities for functional studies. The development of peptide nucleic acids (PNAs) to interfere with gene expression in Buchnera provides a powerful approach for in vivo gene manipulation . Applying these techniques to target uppP could directly assess its role in Buchnera survival and symbiotic function, potentially revealing new aspects of this enzyme's biological significance.

From an evolutionary perspective, comparative analysis of uppP from Buchnera with homologous enzymes from free-living bacteria could reveal adaptations specific to the symbiotic lifestyle. Such comparisons might identify unique features that have evolved in response to the specialized intracellular environment of aphid cells, providing insights into the molecular mechanisms of symbiont adaptation.

The development of selective inhibitors targeting uppP represents a promising direction for applied research. Such compounds could potentially disrupt the aphid-Buchnera symbiosis, offering a novel approach for managing aphid pests in agriculture . Additionally, understanding the specificity determinants of uppP could guide the development of narrow-spectrum antimicrobials that selectively target specific bacterial species while sparing beneficial microorganisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
uppP; bacA; upk; bbp_058; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Target Names
uppP
Target Protein Sequence
MTMTTNIFNAIILGIVEGITEFFPISSSGHLLIFTNILEMKNNEIKILNTIIQTGAALSI LLHFKEKFVIFLEQIFICKQITKKNDLIYHHIILGNIPIIFIGLCIYQYIKYLSNFYSII YALIFGTILLILTEISKTKISSNKNIETPQILIIGIFQCLALWPGFSRSCATISAGILSG LKQSKSVEFSFILSVPIFFGASVLDVINNFYDISINNIPMLFSGFLSAFITSNIVIKRCL NTMKNCSLIPFIIYRSILSIIIYLFFMH
Uniprot No.

Target Background

Function

This recombinant Buchnera aphidicola subsp. Baizongia pistaciae undecaprenyl-diphosphatase (UppP) catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers bacitracin resistance.

Database Links

KEGG: bab:bbp_058

STRING: 224915.bbp058

Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Buchnera aphidicola and why is it significant in research?

    Buchnera aphidicola is an obligate endosymbiont of aphids that cannot be cultured outside of its hosts. It exists as diverse strains in different aphid species and has been maternally transmitted in aphids for more than 100 million years according to phylogenetic reconstructions . The significance of B. aphidicola in research stems from its highly reduced genome, conserved gene order, and absence of gene acquisition, despite the rapid evolution of its encoded proteins . Aphids depend on B. aphidicola for the biosynthesis of essential amino acids and as an integral component of their embryonic development . The organism represents an excellent model for studying genome reduction, host-symbiont co-evolution, and metabolic complementation in obligate endosymbiotic relationships.

  • What is the function of Undecaprenyl-diphosphatase (uppP) in Buchnera aphidicola?

    Undecaprenyl-diphosphatase (uppP), also known as Bacitracin resistance protein, is an enzyme (EC 3.6.1.27) involved in bacterial cell wall biosynthesis . In Buchnera aphidicola subsp. Baizongia pistaciae, uppP functions in the recycling of undecaprenyl pyrophosphate to undecaprenyl phosphate, a critical carrier molecule for cell wall precursors. The protein consists of 268 amino acids and contains multiple transmembrane domains, consistent with its role as a membrane-embedded enzyme . The gene encoding this protein (uppP, synonyms: bacA, upk) is identified by the ordered locus name bbp_058 in the Buchnera aphidicola subsp. Baizongia pistaciae genome .

  • How does the genomic context of uppP fit into the broader operon structure of Buchnera aphidicola?

    The genomic organization of Buchnera aphidicola is characterized by a higher degree of polycistronic transcription compared to free-living bacteria like E. coli. Studies have shown that B. aphidicola transcription units (TUs) contain more genes on average (2.12) than those in E. coli (1.63), with polycistronic TUs containing an average of 3.43 genes compared to 3.17 in E. coli . The uppP gene likely exists within one of these polycistronic transcription units, though its specific operon structure is not explicitly detailed in the provided search results.

    Experimental validation using RT-PCR has demonstrated that many gene pairs predicted as separate transcription units are actually co-transcribed in Buchnera, suggesting that the actual operon map may be even more polycistronic than predicted by computational methods . This has implications for the regulation of uppP expression, which may be coordinated with functionally related or unrelated genes within the same transcription unit.

  • What are the optimal storage conditions for Recombinant Buchnera aphidicola uppP?

    Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Undecaprenyl-diphosphatase should be stored at -20°C for regular storage. For extended storage periods, conservation at -20°C or -80°C is recommended . The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for protein stability . It's important to note that repeated freezing and thawing cycles should be avoided to maintain protein integrity. For short-term use over periods up to one week, working aliquots can be stored at 4°C .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.