Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0056 membrane protein bbp_399 (bbp_399)

Shipped with Ice Packs
In Stock

Description

Biological Context in Buchnera aphidicola

Buchnera aphidicola subsp. Baizongia pistaciae is a mutualistic symbiont of aphids, providing essential amino acids like tryptophan . Its genome is reduced to ~640 kb, retaining only critical metabolic pathways . bbp_399 is one of 582 protein-coding genes in Buchnera genomes, though its specific role remains uncharacterized .

FeatureDetails
Host organismBuchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Genomic contextChromosomal locus bbp_399
Structural prediction4–8 transmembrane helices (computational models)
Functional categoryMembrane protein (UPF0056 family)

Membrane Protein Stability and Design

  • Stability: Magnetic tweezer experiments show computationally designed transmembrane proteins (like bbp_399 homologs) exhibit exceptional mechanical stability in lipid bilayers .

  • Symbiosis adaptation: Buchnera’s membrane transporters are simplified compared to free-living bacteria, reflecting host dependency .

Genomic and Evolutionary Insights

  • Gene retention: Despite massive gene loss, Buchnera retains bbp_399, suggesting an unresolved critical function .

  • Aphid host specificity: Strains like Baizongia pistaciae show unique membrane architectures (e.g., double membranes in some lineages) .

Limitations and Future Directions

  • Functional annotation: The protein’s biochemical role remains unverified.

  • Structural data: No experimental 3D structure is available; computational models require validation .

  • Host interaction studies: Aphid bacteriocyte localization experiments could clarify its role in symbiosomes .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
bbp_399; UPF0056 membrane protein bbp_399
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Target Names
bbp_399
Target Protein Sequence
MKEIISVTILLILIMDPLGNLPIFMSILKHLEPQRRKKILIREMMIALLIMLLFLFAGEK ILIFLNLRAETVSVSGGIILFLIAIKMIFPTYESKKKSGNIIKREEPFLVPLAIPLVAGP SLLATLMLLSHQYPKKILYLIGSLLIAWMITVVILLLSDIFLRLFGSKGVNALERLMGLI LIMLSTQMFLDGIKSWFYI
Uniprot No.

Target Background

Database Links

KEGG: bab:bbp_399

STRING: 224915.bbp399

Protein Families
UPF0056 (MarC) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of bbp_399 membrane protein?

The bbp_399 protein from Buchnera aphidicola subsp. Baizongia pistaciae is a UPF0056 family membrane protein consisting of 199 amino acids . Its primary sequence indicates a highly hydrophobic profile consistent with a typical membrane-spanning protein. The amino acid sequence is: MKEIISVTILLILIMDPLGNLPIFMSILKHLEPQRRKKILIREMMIALLIMLLFLFAGEKILIFLNLRAETVSVSGGIILFLIAIKMIFPTYESKKKSGNIIKREEPFLVPLAIPLVAGPSLLATLMLLSHQYPKKILYLIGSLLIAWMITVVILLLSDIFLRLFGSKGVNALERLMGLILIMLSTQMFLDGIKSWFYI .

Analysis of this sequence reveals multiple potential transmembrane domains, suggesting its integration into the bacterial membrane. Secondary structure prediction indicates a predominance of alpha-helical regions interspersed with connecting loops, which is characteristic of membrane transport proteins. The protein likely forms a channel or transporter within the bacterial membrane, though its precise folding pattern requires experimental validation through crystallography or cryo-EM studies.

What is the genomic context of the bbp_399 gene within the Buchnera genome?

The bbp_399 gene exists within the highly reduced genome of Buchnera aphidicola, an endosymbiont that has undergone extensive gene loss through coevolution with its aphid host . Recent comparative genomic analyses have shown that Buchnera genomes are mostly collinear, with a pan-genome containing 684 genes . The bbp_399 gene appears to be part of the 256 core genes maintained across various Buchnera lineages, suggesting its essential function in the endosymbiont's biology .

The genomic organization around bbp_399 remains relatively stable despite the high sequence divergence observed in Buchnera genomes. This conservation of gene order, despite sequence variation, is a characteristic feature of Buchnera genomics and suggests functional constraints on genome rearrangements. The retention of bbp_399 in the core genome, despite substantial gene loss in each Buchnera lineage, indicates its potential importance in maintaining the obligate symbiotic relationship with aphid hosts.

How does bbp_399 protein function differ from other membrane proteins in Buchnera aphidicola?

The bbp_399 protein, as a member of the UPF0056 membrane protein family, likely serves a specialized function within the Buchnera aphidicola membrane that distinguishes it from other membrane proteins. While the exact function remains to be fully characterized, comparative analysis with other Buchnera membrane proteins shows several distinctive features.

Unlike many nutrient transporters that facilitate the exchange of essential compounds between Buchnera and its aphid host, the bbp_399 protein may be involved in maintaining membrane integrity or cellular homeostasis. The protein's conservation across different Buchnera lineages, despite substantial genomic reduction, suggests a fundamental role that cannot be compensated by other proteins .

Other Buchnera membrane proteins often show clear homology to well-characterized bacterial transporters, whereas bbp_399 belongs to a poorly characterized protein family (UPF0056). This difference highlights potential novel functions that may be specific to the endosymbiotic lifestyle. Electrophysiological studies comparing bbp_399 with other Buchnera membrane proteins would help elucidate these functional differences.

What are the optimal conditions for expressing recombinant bbp_399 protein in E. coli?

Expressing recombinant bbp_399 protein in E. coli requires optimization of several parameters due to its hydrophobic nature as a membrane protein. The recommended expression conditions are:

  • Expression System: E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3), which are derivatives of BL21(DE3) with adaptations for membrane protein tolerance .

  • Expression Vector: A vector containing a strong inducible promoter (T7 or tac) with an N-terminal His-tag for purification purposes .

  • Induction Parameters: IPTG concentration of 0.1-0.5 mM, induction at lower temperatures (16-25°C) rather than 37°C to slow protein production and aid proper folding.

  • Media and Growth Conditions: Rich media supplemented with glucose for initial growth, followed by induction in media containing glycerol instead of glucose to prevent catabolite repression.

  • Extraction Buffer: Use of mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) for membrane solubilization.

For optimal results, expression should be monitored via small-scale test expressions before scaling up, with western blotting against the His-tag to confirm successful expression. The membrane fraction should be isolated through differential centrifugation before detergent-based extraction of the target protein.

What purification strategies are most effective for isolating recombinant bbp_399 with high purity?

Purifying recombinant His-tagged bbp_399 protein requires a multi-step approach to achieve high purity while maintaining protein integrity:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with a gradient elution of imidazole (20-500 mM) .

  • Detergent Exchange: During purification, consider detergent exchange if the initial solubilization detergent is not optimal for downstream applications.

  • Secondary Purification: Size exclusion chromatography (SEC) to separate monomeric protein from aggregates and to remove remaining contaminants.

  • Quality Assessment: SDS-PAGE analysis confirms purity (>90% as indicated in commercial preparations) , while dynamic light scattering can assess monodispersity.

  • Storage Conditions: The purified protein should be stored in buffer containing Tris/PBS with 6% trehalose at pH 8.0 . For long-term storage, addition of 5-50% glycerol and aliquoting before freezing at -20°C/-80°C is recommended to prevent repeated freeze-thaw cycles .

The expected yield from a well-optimized expression system is typically 1-5 mg of purified protein per liter of bacterial culture, though this may vary based on expression conditions and specific purification protocols employed.

How can researchers effectively reconstitute bbp_399 into proteoliposomes for functional studies?

Reconstituting bbp_399 into proteoliposomes is essential for functional studies of this membrane protein. A systematic approach includes:

  • Lipid Selection: Utilize E. coli polar lipid extract or synthetic lipid mixtures (POPE:POPG at 3:1 ratio) to mimic the native membrane environment.

  • Reconstitution Methods:

    • Detergent Removal: Gradually remove detergent using Bio-Beads or dialysis

    • Direct Incorporation: Mix detergent-solubilized protein with preformed liposomes

  • Protein-to-Lipid Ratio: Start with 1:100 to 1:200 (w/w) for initial studies, then optimize based on functional assays.

  • Buffer Composition: Reconstitution buffer should contain 20 mM HEPES (pH 7.4), 100 mM KCl, and 5% glycerol.

  • Verification of Incorporation:

    • Freeze-fracture electron microscopy to visualize protein distribution

    • Sucrose density gradient centrifugation to confirm protein association with liposomes

    • Proteoliposome flotation assays to verify membrane integration

  • Functional Validation: Post-reconstitution functionality can be assessed through:

    • Membrane potential measurements using voltage-sensitive dyes

    • Ion flux assays with appropriate fluorescent indicators

    • Patch-clamp electrophysiology on giant proteoliposomes

The reconstituted proteoliposomes should be used immediately for functional assays or stored at 4°C for short periods (1-2 days). For longer storage, flash-freezing in liquid nitrogen and storage at -80°C with cryoprotectants is recommended, although some functional loss may occur.

How does bbp_399 contribute to the symbiotic relationship between Buchnera and aphids?

The bbp_399 membrane protein potentially plays a crucial role in the obligate symbiotic relationship between Buchnera aphidicola and its aphid hosts, though specific mechanisms require further investigation. Phylogenomic analysis across 72 complete Buchnera genomes has demonstrated significant coevolution between these endosymbionts and their aphid hosts at individual, species, generic, and tribal levels .

The retention of bbp_399 in the core genome (one of 256 core genes identified) despite extensive gene loss throughout Buchnera evolution suggests its essential function in maintaining the symbiosis . As a membrane protein, bbp_399 likely facilitates communication between the bacterial endosymbiont and the host cell environment, potentially through:

  • Membrane stabilization within the specialized host bacteriocytes

  • Selective transport of metabolites essential for the symbiotic relationship

  • Maintenance of proper cellular compartmentalization

  • Signal transduction between host and symbiont

Experimental approaches to elucidate bbp_399's specific role could include:

  • Localization studies using fluorescently tagged protein in aphid bacteriocytes

  • Comparative proteomics of the bacteriocyte membrane interface

  • Metabolite transport assays using reconstituted proteoliposomes

  • Molecular dynamics simulations to identify potential interaction partners

The complex obligate nature of the Buchnera-aphid relationship makes direct genetic manipulation challenging, but modern approaches like RNA interference in the host or careful metabolic labeling could provide insights into bbp_399's functional significance.

What structural and functional homologs of bbp_399 exist in other bacterial endosymbionts?

The UPF0056 membrane protein family, to which bbp_399 belongs, has limited characterized homologs across bacterial endosymbionts, making comparative analysis particularly valuable:

Endosymbiont SpeciesHost OrganismProtein HomologSequence Identity to bbp_399Known/Predicted Function
Buchnera aphidicola (other strains)Various aphid speciesUPF0056 family proteins75-95%Membrane integrity maintenance
Blochmannia floridanusCarpenter antsBfl_403~40%Predicted transporter
Wigglesworthia glossinidiaTsetse fliesHypothetical membrane protein~35%Unknown
Sodalis glossinidiusTsetse fliesUPF0056 family protein~30%Unknown
Free-living γ-proteobacteriaN/AYhgN family proteins25-35%Stress response

Structural prediction algorithms suggest that these homologs share a conserved core of 4-6 transmembrane helices, despite sequence divergence. The varying degrees of sequence conservation across different endosymbiont lineages potentially reflect adaptation to specific host environments and metabolic requirements.

Functional characterization of these homologs is limited, but experimental evidence from free-living bacterial relatives suggests potential roles in membrane stress response, particularly under nutrient limitation conditions. The higher conservation of these proteins in obligate endosymbionts compared to facultative ones suggests specialized adaptation to the intracellular lifestyle.

Researchers investigating bbp_399 should consider comparative studies with these homologs, particularly focusing on regions of high sequence conservation, which may indicate functionally critical domains for the endosymbiotic lifestyle.

How can researchers use recombinant bbp_399 protein to study Buchnera-aphid coevolution?

Recombinant bbp_399 protein offers a valuable tool for investigating the molecular basis of Buchnera-aphid coevolution, enabling studies that were previously impractical due to the unculturable nature of this obligate endosymbiont. Strategic applications include:

  • Antibody Production and Immunolocalization:

    • Generate specific antibodies against recombinant bbp_399

    • Use these for immunohistochemistry to map protein distribution in aphid bacteriocytes

    • Track evolutionary changes in localization patterns across aphid species

  • Protein-Protein Interaction Studies:

    • Perform pull-down assays using the His-tagged recombinant protein to identify aphid host proteins that interact with bbp_399

    • Conduct crosslinking mass spectrometry to map interaction interfaces

    • Compare interaction partners across evolutionarily distinct aphid lineages

  • Evolutionary Biochemistry:

    • Express bbp_399 variants from different Buchnera strains

    • Perform comparative functional assays to identify lineage-specific adaptations

    • Correlate functional differences with host specialization

  • Structure-Function Analysis:

    • Use site-directed mutagenesis to modify conserved residues

    • Assess functional impact through reconstitution experiments

    • Identify critical residues maintained through coevolutionary processes

Recent phylogenomic analyses have demonstrated significant coevolution between Buchnera and aphids at multiple taxonomic levels . The bbp_399 protein, as part of the core genome containing 256 genes, represents a molecular marker of this coevolutionary history. Examining sequence variations in bbp_399 across diverse aphid hosts could reveal signatures of selection and adaptation, providing insights into the molecular mechanisms driving this ancient symbiotic relationship.

What strategies can overcome protein aggregation during recombinant bbp_399 expression?

Membrane proteins like bbp_399 are prone to aggregation during heterologous expression, which can significantly reduce yield and functionality. Implementing the following strategies can mitigate this challenge:

  • Expression System Modifications:

    • Use C41(DE3) or C43(DE3) E. coli strains specifically engineered for membrane protein expression

    • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to assist proper folding

    • Utilize expression vectors with tunable promoter strength to control expression rate

  • Growth Condition Optimizations:

    • Reduce induction temperature to 16-20°C to slow protein synthesis

    • Decrease IPTG concentration to 0.1-0.2 mM for gentler induction

    • Supplement growth media with betaine (2 mM) and sorbitol (0.5 M) as chemical chaperones

  • Fusion Tag Approaches:

    • Express with fusion partners known to enhance membrane protein solubility (MBP, SUMO)

    • Consider dual-tagging strategies with removable solubility tags

  • Detergent Screening:

    • Systematically test a panel of detergents for extraction efficiency

    • Consider mild detergents like DDM, LMNG, or fluorinated surfactants

    • Evaluate detergent mixtures that may provide better solubilization

  • Monitoring Aggregation:

    • Use size exclusion chromatography to quantify monomeric vs. aggregated protein

    • Employ dynamic light scattering to assess protein monodispersity

    • Apply thermal stability assays to identify stabilizing conditions

Implementing these approaches systematically can significantly improve the yield of properly folded bbp_399 protein. Researchers should maintain detailed records of conditions tested, as optimal parameters may vary based on specific experimental setups and downstream applications.

How can researchers confirm the proper folding and functionality of purified recombinant bbp_399?

Confirming proper folding and functionality of purified recombinant bbp_399 is crucial before proceeding to detailed characterization studies. A comprehensive validation approach includes:

  • Biophysical Characterization:

    • Circular Dichroism (CD) Spectroscopy: Assess secondary structure content, particularly alpha-helical content expected for membrane proteins

    • Thermal Denaturation: Monitor unfolding transitions as indicators of structural stability

    • Intrinsic Fluorescence: Evaluate tertiary structure organization through tryptophan fluorescence

  • Functional Verification:

    • Reconstitution into Liposomes: Successful incorporation indicates proper folding

    • Orientation Analysis: Determine if the protein inserts in a uniform orientation using protease protection assays

    • Membrane Integrity Assays: Test if reconstituted protein affects membrane permeability or stability

  • Interaction Studies:

    • Binding Assays: Verify interactions with potential ligands or binding partners

    • Co-purification: Identify any consistently co-purifying factors that may be functional partners

  • Structural Integrity:

    • Limited Proteolysis: Well-folded proteins show discrete, reproducible fragmentation patterns

    • Size Exclusion Chromatography: Monodisperse elution profiles indicate uniform folding

    • Native PAGE: Migration patterns can distinguish between folded and unfolded states

  • Comparison with Native Protein:

    • When possible, compare properties with the native protein extracted from Buchnera

    • Consider mass spectrometry to verify post-translational modifications

The properly folded recombinant bbp_399 is expected to show predominantly alpha-helical secondary structure (40-60%), thermal stability appropriate for a membrane protein, and the ability to insert into lipid bilayers with a defined orientation. These parameters provide baseline measurements for subsequent functional studies and can help identify conditions that maintain native-like protein conformations.

What approaches can address challenges in obtaining high-resolution structural data for bbp_399?

Obtaining high-resolution structural data for membrane proteins like bbp_399 presents significant challenges. Researchers can employ the following approaches to overcome these difficulties:

  • X-ray Crystallography Optimization:

    • Lipidic Cubic Phase (LCP) Crystallization: Often more successful for membrane proteins than traditional vapor diffusion methods

    • Surface Engineering: Introduce mutations that reduce flexible regions or enhance crystal contacts

    • Antibody Fragment Co-crystallization: Use Fab or nanobody fragments to provide additional crystal contacts

    • Fusion Protein Approaches: Incorporate crystallization chaperones like T4 lysozyme or BRIL into flexible loops

  • Cryo-EM Adaptations:

    • Amphipol Reconstitution: Replace detergents with amphipols for improved particle distribution

    • Nanodiscs Assembly: Reconstitute protein into defined lipid nanodiscs for enhanced visibility

    • High-concentration Screening: Optimize sample concentration and grid preparation protocols

    • Focused Refinement: Apply computational approaches to deal with conformational heterogeneity

  • NMR Strategies:

    • Selective Isotope Labeling: Focus on specific regions of interest rather than the whole protein

    • Solid-state NMR: Apply to reconstituted proteoliposomes or precipitated protein

    • Fragment-based Approach: Study structurally independent domains separately

  • Hybrid Methods:

    • Integrate low-resolution data from small-angle X-ray scattering (SAXS) with computational models

    • Combine negative-stain EM with molecular dynamics simulations

    • Use crosslinking mass spectrometry to define distance constraints for modeling

  • Computational Approaches:

    • Apply AlphaFold2 or RoseTTAFold for initial structural prediction

    • Refine models using molecular dynamics simulations in explicit membrane environments

    • Validate predictions through targeted mutagenesis of key residues

The recent advances in cryo-EM and computational prediction methods offer promising avenues for structural characterization of bbp_399. While challenging, determining the structure would provide invaluable insights into its function in the Buchnera-aphid symbiotic relationship and potentially reveal unique adaptations specific to its endosymbiotic lifestyle.

How might comparative genomics of bbp_399 across Buchnera strains inform our understanding of host adaptation?

Comparative genomics of bbp_399 across diverse Buchnera strains presents a powerful approach to understanding host adaptation mechanisms. Recent studies analyzing 72 complete Buchnera genomes have already revealed significant coevolutionary patterns between these endosymbionts and their aphid hosts . Further exploration of bbp_399 specifically could yield valuable insights:

  • Sequence Evolution Analysis:

    • Calculate evolutionary rates (dN/dS) of bbp_399 compared to other core genes

    • Identify positively selected residues that may reflect host-specific adaptations

    • Map amino acid changes to predicted functional domains

  • Synteny and Genomic Context:

    • Examine conservation of gene order around bbp_399 across Buchnera strains

    • Identify potential operonic structures or co-evolving gene clusters

    • Analyze promoter regions for regulatory differences

  • Copy Number Variation:

    • Assess whether bbp_399 exists as single copy or shows lineage-specific duplications

    • Investigate tandem gene duplication events that may provide functional redundancy

    • Correlate gene dosage with host ecological niches

  • Host-Specific Signatures:

    • Group bbp_399 sequences by host taxonomy to identify clade-specific variations

    • Correlate sequence changes with host plant specialization or environmental factors

    • Develop phylogenetic markers based on bbp_399 variation patterns

  • Functional Domain Conservation:

    • Identify highly conserved protein regions likely essential for core functions

    • Map variable regions that may reflect host-specific adaptations

    • Predict transmembrane topology changes that might alter protein function

The pan-genome analysis of Buchnera has revealed 684 total genes across strains, with only 256 comprising the core genome . The persistence of bbp_399 within this core set suggests fundamental importance, while sequence variations may hold clues to specialized adaptations. This comparative approach can generate testable hypotheses about structure-function relationships and guide experimental designs targeting specific protein regions for functional characterization.

What novel experimental systems could be developed to study bbp_399 function in vivo?

The obligate nature of Buchnera aphidicola presents significant challenges for in vivo functional studies of bbp_399. Innovative experimental systems could overcome these limitations:

  • Heterologous Expression in Model Bacteria:

    • Express bbp_399 in genetically tractable γ-proteobacteria related to Buchnera

    • Create chimeric proteins with homologous regions from model organisms

    • Develop conditional expression systems to study potential toxic effects

  • Aphid Cell Culture Advancements:

    • Develop improved aphid cell culture systems compatible with Buchnera

    • Create bacteriocyte-like cellular environments for ex vivo studies

    • Establish transfection protocols for aphid cells to manipulate host-symbiont interfaces

  • Organoid or Microfluidic Systems:

    • Design artificial bacteriocyte-like structures using microfluidic technology

    • Create gradient-generating systems to mimic the symbiotic environment

    • Develop organoid-like cultures from aphid bacteriocytes

  • Advanced Imaging Approaches:

    • Apply expansion microscopy to enhance visualization of bacteriocyte structures

    • Utilize correlative light and electron microscopy for protein localization

    • Implement live-cell super-resolution imaging of tagged proteins

  • Genetic Manipulation Strategies:

    • Explore CRISPR-mediated manipulation of aphid host genes interacting with bbp_399

    • Develop RNA interference approaches targeting bbp_399 expression

    • Create conditional expression systems for modified Buchnera within host cells

  • Synthetic Biology Approaches:

    • Reconstruct minimal Buchnera-like systems in laboratory strains

    • Engineer artificial symbiotic systems incorporating bbp_399

    • Create biosensors based on bbp_399 interaction partners

These novel systems would provide unprecedented opportunities to study bbp_399 function within the context of the symbiotic relationship. While technically challenging, such approaches could overcome the current limitations imposed by the unculturable nature of Buchnera and the complexity of its obligate association with aphid hosts.

How might structural information about bbp_399 inform the development of molecular tools for studying endosymbiont biology?

Detailed structural information about bbp_399 could catalyze the development of innovative molecular tools for broader studies of endosymbiont biology:

  • Targeted Antibody Development:

    • Design epitope-specific antibodies based on exposed protein regions

    • Create conformation-specific antibodies that recognize functional states

    • Develop cross-reactive antibodies for comparative studies across endosymbiont species

  • Small Molecule Modulators:

    • Identify binding pockets for potential ligand development

    • Design specific inhibitors or activators of bbp_399 function

    • Create chemical probes for studying protein dynamics in situ

  • Biosensor Engineering:

    • Develop FRET-based sensors incorporating bbp_399 conformational changes

    • Create detection systems for monitoring endosymbiont-host interactions

    • Design reporter systems for studying membrane dynamics in bacteriocytes

  • Protein Engineering Applications:

    • Identify stable domains suitable for creating chimeric proteins

    • Design membrane-anchoring tags based on bbp_399 transmembrane regions

    • Develop expression tags optimized for endosymbiont systems

  • Nanotechnology Integration:

    • Create protein-based nanoparticles for targeted delivery to bacteriocytes

    • Develop membrane-mimetic surfaces incorporating bbp_399 for interaction studies

    • Engineer biosensing platforms based on bbp_399 structural elements

  • Computational Tool Development:

    • Build machine learning algorithms for predicting endosymbiont protein functions

    • Develop specialized molecular dynamics force fields for endosymbiont membrane proteins

    • Create databases of structural motifs unique to obligate endosymbionts

The structural information derived from studies of bbp_399 would provide templates for understanding similar proteins in other endosymbiont systems. This cross-application potential extends beyond Buchnera to diverse symbiotic systems including Wolbachia, Blochmannia, and other bacterial endosymbionts, potentially revealing common molecular mechanisms underlying these evolutionarily distinct but functionally convergent symbiotic relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.