Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0114 protein in repA1-repA2 intergenic region (bbp_601)

Shipped with Ice Packs
In Stock

Description

Introduction to Buchnera aphidicola and its Proteins

Buchnera aphidicola is a Gram-negative bacterium that exists as an obligate endosymbiont within aphids, living inside specialized cells called bacteriocytes . This symbiotic relationship, established over 100 million years ago, is crucial for the survival of aphids, as Buchnera provides essential amino acids that are lacking in the aphids' phloem sap diet . Due to its endosymbiotic lifestyle, Buchnera has undergone significant genome reduction, retaining only genes necessary for its specific functions within the host .

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0114 Protein in repA1-repA2 Intergenic Region (bbp_601)

The "Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0114 protein in repA1-repA2 intergenic region (bbp_601)" refers to a specific protein derived from the Buchnera aphidicola subspecies found in the aphid Baizongia pistaciae . This protein is also known as UPF0114 protein in the repA1-repA2 intergenic region and is encoded by the gene bbp_601 . The protein has a UniProt ID of Q89B48 and consists of 165 amino acids .

Recombinant production of this protein involves expressing the bbp_601 gene in a host organism, such as E. coli, and purifying the resulting protein for research purposes . Typically, a His-tag is added to the protein to facilitate purification .

Characteristics of the bbp_601 Protein

CharacteristicDescription
SpeciesBuchnera aphidicola subsp. Baizongia pistaciae
Gene Namebbp_601
SynonymsUPF0114 protein in repA1-repA2 intergenic region
UniProt IDQ89B48
Protein Length165 amino acids
SourceE. coli
TagHis-Tag
PurityGreater than 90% as determined by SDS-PAGE
FormLyophilized powder
AA SequenceMEKLIERIIYASRWLMFPVYIGLSLGFILLTLKFFQQIIFVIPKILMMSESGLVLVVLSLIDISLVGGLLVMVMFSGYENFISKMEIKTDKKKLGWMGTMDVNSIKNKVASSIVAISSVHSLRLFMDAEKISNDQIMWCVLIHLTFVISAFGMACIDKMSKRGYS
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Expression Region1-165

Genomic Context and Function

The bbp_601 gene is located in the repA1-repA2 intergenic region of Buchnera aphidicola subsp. Baizongia pistaciae . Intergenic regions often contain regulatory elements or genes with unique functions. The UPF0114 designation indicates that this protein belongs to a family of proteins with unknown function (UPF = Unknown Protein Function) . Further research is needed to elucidate the precise biochemical function and role of bbp_601 in the Buchnera-aphid symbiosis .

Potential Functions and Evolutionary Significance

  • Positive Selection: Genes encoding surface proteins in Buchnera, such as OmpA and OmpF, are subject to positive selection, suggesting their role in coevolutionary interactions with the host aphid .

  • Translational Robustness: There is selection in Buchnera to increase the robustness of proteins to misfolding translation errors .

  • Metabolic Functions: Buchnera retains genes involved in the biosynthesis of essential amino acids, highlighting its crucial role in the aphid's metabolism .

  • Gene Movement: Genes related to leucine and tryptophan biosynthesis can move between plasmid and chromosome locations in the Buchnera genome, indicating a dynamic evolutionary process .

Research Applications

Recombinant bbp_601 protein can be used in various research applications:

  • Antibody Production: To generate antibodies for detecting and studying the protein in Buchnera cells.

  • Protein Interaction Studies: To identify other proteins that interact with bbp_601, providing insights into its function .

  • Structural Studies: To determine the three-dimensional structure of the protein, which can aid in understanding its function.

  • Functional Assays: To investigate the biochemical activity of the protein and its role in the Buchnera-aphid symbiosis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
bbp_601; UPF0114 protein in repA1-repA2 intergenic region
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Target Names
bbp_601
Target Protein Sequence
MEKLIERIIYASRWLMFPVYIGLSLGFILLTLKFFQQIIFVIPKILMMSESGLVLVVLSL IDISLVGGLLVMVMFSGYENFISKMEIKTDKKKLGWMGTMDVNSIKNKVASSIVAISSVH SLRLFMDAEKISNDQIMWCVLIHLTFVISAFGMACIDKMSKRGYS
Uniprot No.

Target Background

Database Links

KEGG: bab:yqhA

Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0114 protein in repA1-repA2 intergenic region?

The UPF0114 protein is a membrane-associated protein encoded in the intergenic region between repA1 and repA2 genes in Buchnera aphidicola. This protein belongs to a family of uncharacterized proteins (UPF0114) that appear conserved across different Buchnera aphidicola subspecies. The protein contains approximately 165-178 amino acids depending on the specific Buchnera subspecies, with the Baizongia pistaciae variant (bbp_601) falling within this range . The protein is encoded within the intergenic region that may play regulatory roles in gene expression, similar to how intergenic regions in other organisms like Babesia contain functional promoters .

How does this protein compare across different Buchnera subspecies?

The UPF0114 protein shows high conservation in sequence and length across different Buchnera aphidicola subspecies, though with some variation. The protein length ranges from 165 amino acids in B. aphidicola subsp. Geoica urticularia and Thelaxes suberi, 166 amino acids in Rhopalosiphum padi, 167 amino acids in Schizaphis graminum and Diuraphis noxia, to 178 amino acids in Tetraneura caerulescens . This variation reflects the evolutionary divergence of these subspecies while maintaining the core protein structure. The high conservation degree suggests evolutionary pressure to maintain this protein's function despite the extensive genome reduction observed in Buchnera aphidicola, indicating potential biological significance .

What is known about the evolutionary context of this protein?

The UPF0114 protein exists within the context of reductive genome evolution in Buchnera aphidicola, an obligate intracellular symbiont of aphids. Genomic studies have revealed that Buchnera established symbiosis with aphids approximately 200 million years ago, followed by extensive genome reduction . While many genes have been lost during this reductive evolution, the conservation of the UPF0114 protein across different Buchnera subspecies suggests it may perform an essential function in the symbiotic relationship. The protein likely predates the diversification of Buchnera and its host, as indicated by its presence across subspecies that diverged 80-150 million years ago .

What expression systems are most suitable for recombinant production?

For the recombinant production of UPF0114 protein from Buchnera aphidicola, several expression systems have been validated with varying advantages:

  • E. coli expression system: This provides the highest yield and shortest turnaround time for UPF0114 protein production. It is particularly suitable for structural studies requiring significant protein quantities .

  • Yeast expression system: Offers good yields while potentially providing some post-translational modifications that may be important for certain functional studies .

  • Insect cell/baculovirus expression system: Though lower yielding than bacterial systems, this approach can provide many of the post-translational modifications necessary for correct protein folding .

  • Mammalian cell expression system: May be utilized when native-like post-translational modifications are critical for retaining the protein's activity .

For most research applications, E. coli-based expression with an N-terminal His-tag is recommended as it balances yield, cost, and purification efficiency, as demonstrated with the Schizaphis graminum subspecies variant .

How can protein folding challenges be addressed for this membrane-associated protein?

The UPF0114 protein contains hydrophobic transmembrane regions, which can present folding challenges during recombinant expression. Computational studies suggest that proteins in Buchnera, including this UPF0114 protein, generally demonstrate smaller folding efficiency compared to proteins from free-living bacteria . To overcome these challenges:

  • Optimize expression temperature: Lower expression temperatures (16-20°C) can slow protein synthesis, allowing more time for proper folding.

  • Include membrane-mimicking agents: Addition of mild detergents or lipids during purification can stabilize membrane-associated regions.

  • Employ solubility-enhancing fusion partners: Fusion tags like MBP (maltose-binding protein) or SUMO can enhance solubility beyond the standard His-tag.

  • Consider native-like conditions: When studying function, recreate the native intracellular environment of Buchnera using appropriate buffer systems that mimic the osmolarity and pH of the aphid bacteriocyte.

  • Codon optimization: Adapt the coding sequence for expression in the chosen host system, especially for E. coli, to overcome potential rare codon issues.

What purification protocol yields the highest purity and activity?

Based on available data on similar UPF0114 proteins, the following purification protocol is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin to capture the His-tagged protein.

  • Buffer composition: Use Tris/PBS-based buffer at pH 8.0 with 6% trehalose as a stabilizing agent .

  • Storage considerations: The purified protein should be stored as lyophilized powder or in solution with 5-50% glycerol at -20°C/-80°C, with aliquoting recommended to avoid freeze-thaw cycles .

  • Reconstitution: Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL before use .

  • Quality control: Confirm purity greater than 90% using SDS-PAGE analysis before proceeding with functional studies .

How is the function of this protein currently understood?

  • Regulatory role: Its location in the intergenic region between repA1 and repA2 suggests a potential role in regulating replication or gene expression, similar to how intergenic regions in Babesia contain functional promoters .

  • Membrane integrity: The predicted transmembrane domains suggest a possible structural role in maintaining membrane integrity in the reduced-genome environment of Buchnera.

  • Host-symbiont interaction: Conservation across Buchnera subspecies despite extensive genome reduction suggests potential importance in the symbiotic relationship with aphid hosts.

  • Replication control: Proximity to repA genes, which are typically involved in plasmid replication, suggests a possible role in controlling the replication of Buchnera's chromosome or plasmids.

Research using deletion mutants or protein-protein interaction studies would be required to definitively establish the function.

What analytical techniques are most appropriate for studying this protein's interactions?

Given the membrane-associated nature and regulatory context of the UPF0114 protein, the following analytical techniques are recommended:

  • Bacterial two-hybrid system: Appropriate for detecting protein-protein interactions while accommodating membrane proteins.

  • Chromatin immunoprecipitation (ChIP): If the protein has DNA-binding capabilities, this technique can identify genomic binding sites.

  • Surface plasmon resonance (SPR): Can quantify binding kinetics with potential interaction partners.

  • Cross-linking mass spectrometry: Identifies interaction partners in their native environment.

  • Fluorescence microscopy with GFP fusion: Determines subcellular localization when expressed in model systems.

  • Electrophoretic mobility shift assay (EMSA): If the protein interacts with DNA, EMSA can confirm binding to specific sequences in the repA1-repA2 region.

These approaches should be complemented with computational predictions of interaction sites based on the protein's sequence and structural features.

How can this protein be leveraged in studying symbiont genome evolution?

The UPF0114 protein represents an excellent model for studying genome reduction and protein evolution in obligate symbionts:

  • Comparative genomics: Analyzing sequence conservation of this protein across Buchnera subspecies can provide insights into the selective pressures operating during symbiont genome reduction.

  • Experimental evolution: Expressing variants of this protein in free-living bacteria can help understand the functional constraints that have maintained it despite genome reduction.

  • Protein folding studies: The computational prediction that Buchnera proteins have lower folding efficiency can be experimentally tested using the UPF0114 protein as a model.

  • Regulatory network reconstruction: Studying the protein's role in potentially regulating the repA genes can illuminate how regulatory networks evolve in reduced genomes.

  • Symbiosis dependency models: Investigating whether this protein interacts with host factors could reveal mechanisms of host-symbiont integration at the molecular level.

What experimental approaches can determine the role of this protein in gene regulation?

To investigate the potential regulatory role of UPF0114 protein in the repA1-repA2 intergenic region:

  • Reporter gene assays: Similar to studies with Babesia bovis rap-1 intergenic regions , construct plasmids with the UPF0114-containing intergenic region controlling reporter gene expression to test promoter activity.

  • Gene knockout/knockdown: Where possible, create deletion mutants or use antisense RNA approaches to reduce expression and observe effects on repA1 and repA2 expression.

  • Heterologous expression systems: Test the ability of the intergenic region to drive gene expression in E. coli or other tractable systems, as demonstrated with other intergenic regions .

  • DNA footprinting: Identify specific DNA sequences that interact with the UPF0114 protein in the intergenic region.

  • Head-to-tail vs. head-to-head orientation experiments: Test whether the orientation of regulatory elements affects gene expression, similar to experiments with rap-1 intergenic regions that showed enhanced expression with head-to-tail orientation .

How does the protein's structure relate to potential functional constraints in a reduced genome context?

In the context of Buchnera's reduced genome, the UPF0114 protein's structure may reflect specific adaptations:

  • Multifunctionality: The protein may have evolved to perform multiple functions as a compensation mechanism for the loss of specialized proteins.

  • Structural simplification: Comparison with homologs in free-living bacteria might reveal simplification in structural elements while maintaining core functional domains.

  • Host-dependency adaptations: Structural features may facilitate interactions with host-derived factors that compensate for lost bacterial functions.

  • Energy conservation: The protein structure may be optimized for energy-efficient synthesis, a critical adaptation in nutrient-limited intracellular environments.

  • Folding efficiency trade-offs: The predicted lower folding efficiency may represent a trade-off between maintaining essential functionality and the constraints of the symbiotic lifestyle.

How can researchers address low expression yields?

When encountering low yields of recombinant UPF0114 protein:

  • Optimize codon usage: Adapt the coding sequence to the preferred codon usage of the expression host.

  • Test different fusion tags: Beyond His-tags, explore MBP, GST, or SUMO fusions which can enhance solubility and expression.

  • Adjust induction parameters: Test various IPTG concentrations (0.1-1.0 mM) and induction temperatures (15-37°C).

  • Evaluate different E. coli strains: BL21(DE3), Rosetta, or C41/C43 strains (specifically designed for membrane proteins) may yield better results.

  • Use auto-induction media: This can provide gentler, more gradual protein expression compared to IPTG induction.

  • Scale-up strategies: Consider moving from shake flasks to controlled bioreactors for improved aeration and pH control during expression.

What approaches can overcome challenges in functional characterization?

Functional characterization of this poorly understood protein presents several challenges:

  • Surrogate systems: Express the protein in model organisms like E. coli and assess effects on growth, membrane properties, or response to stressors.

  • Complementation studies: Test whether the UPF0114 protein can rescue phenotypes in bacteria with mutations in genes of related function.

  • Co-expression with interacting partners: Identify and co-express potential interacting proteins from Buchnera or the aphid host.

  • Comparative analysis: Compare the properties of UPF0114 proteins from different Buchnera subspecies to identify conserved functional elements.

  • Domain swapping: Create chimeric proteins by swapping domains with functionally characterized proteins to identify functional regions.

  • In silico analysis: Utilize advanced computational methods to predict function based on subtle sequence or structural similarities to characterized proteins.

How can researchers validate experimental results given the limitations of working with endosymbiont proteins?

Validation strategies for experimental results include:

  • Multiple expression systems: Confirm findings across different expression systems to rule out artifacts.

  • Complementary techniques: Use orthogonal methods to verify protein-protein or protein-DNA interactions.

  • Structural validation: Confirm protein folding through circular dichroism or limited proteolysis before functional studies.

  • Negative controls: Include closely related but functionally distinct proteins as controls in interaction studies.

  • Concentration-dependent effects: Perform experiments across a range of protein concentrations to establish dose-response relationships.

  • In vivo correlation: Where possible, correlate in vitro findings with observations in the Buchnera-aphid system, perhaps using microscopy or transcriptomic approaches.

What are the most promising avenues for future research on this protein?

The UPF0114 protein in repA1-repA2 intergenic region presents several compelling research opportunities:

  • Structural determination: Solving the three-dimensional structure would provide invaluable insights into function and evolutionary adaptations.

  • Host-symbiont interaction studies: Investigating potential interactions with aphid host factors could reveal mechanisms of symbiotic integration.

  • Comparative functional genomics: Systematically comparing the function of this protein across different Buchnera subspecies could illuminate evolutionary constraints.

  • Regulatory network mapping: Defining the role of this protein in gene regulation could enhance understanding of how reduced genomes maintain essential functions.

  • Synthetic biology applications: The compact nature and potential regulatory functions of this protein could be valuable in designing minimal synthetic cells or optimized expression systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.