Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0259 membrane protein bbp_256 (bbp_256)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
The shelf life of this product is dependent on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
bbp_256; UPF0259 membrane protein bbp_256
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Target Names
bbp_256
Target Protein Sequence
MHITANSLFRDTIHFLRSKWPIIVTFVLLSSTITVVIDSIITPNARSLLAFYQLDIKKYH SLLDFVRTLTIDQQKLLLYASIAKSFSLLIGSTFLLGNLITFIQMTSYKKNITLSIFNNI PYKTFFKLLQLIFTTTIITQLGFLLYFIPGFTTIILFSLSPIILLIEEKTILNSIYASIN ITLSNFKIIVPAIIFWLCFKIFIILIISYFKFFSDFLAYFILNLCINFISSILIIYLFRC YMILPKFLKN
Uniprot No.

Target Background

Database Links

KEGG: bab:bbp_256

STRING: 224915.bbp256

Protein Families
UPF0259 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structural classification of the bbp_256 membrane protein?

The bbp_256 protein is classified as a multi-pass transmembrane protein belonging to the UPF0259 family. It is localized to the cell membrane of Buchnera aphidicola subsp. Baizongia pistaciae. The full-length protein consists of 250 amino acids with the expression region spanning positions 1-250 . The protein features multiple transmembrane domains that traverse the bacterial membrane, consistent with its classification as a multi-pass membrane protein .

What is known about the cellular localization and membrane topology of bbp_256?

The bbp_256 protein is specifically localized to the cell membrane of Buchnera aphidicola. As a multi-pass membrane protein, it contains multiple hydrophobic domains that span the phospholipid bilayer . The protein's topology is particularly interesting in the context of B. pistaciae, as this Buchnera strain has evolved a unique double membrane system, having lost all of its outer-membrane integral proteins, unlike other Buchnera strains that maintain a three-membraned system . This distinctive membrane architecture likely influences the functional integration and orientation of bbp_256 within the cellular envelope.

What expression systems and purification strategies are effective for producing recombinant bbp_256?

The recombinant bbp_256 protein is successfully expressed using in vitro E. coli expression systems . For optimal expression, an N-terminal 10xHis-tag is typically incorporated, facilitating subsequent purification via affinity chromatography . The expression construct should include the complete coding region (amino acids 1-250) to ensure proper folding and retention of native structure.

When working with this membrane protein, several methodological considerations should be addressed:

  • Detergent selection: Screen multiple detergents (e.g., DDM, LDAO, or Triton X-100) to identify optimal solubilization conditions

  • Buffer optimization: Establish stability-enhancing buffer conditions (typically Tris/PBS-based, pH 8.0) with appropriate additives like trehalose (6%)

  • Temperature control: Maintain lower temperatures during expression to prevent inclusion body formation

  • Fusion partner evaluation: Consider fusion tags beyond His-tag if increased solubility is required

For long-term storage, the protein can be maintained in either liquid form (-20°C/-80°C for 6 months) or as a lyophilized powder (-20°C/-80°C for 12 months) .

How can researchers effectively reconstitute bbp_256 into membrane systems for functional studies?

Reconstitution of bbp_256 into membrane systems requires careful consideration of the protein's native membrane environment. Effective methodological approaches include:

  • Liposome incorporation: Prepare lipid mixtures mimicking bacterial membranes, typically containing phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin in ratios reflective of bacterial membranes. After detergent solubilization of the protein, mix with lipid vesicles and remove detergent gradually using dialysis or adsorbent beads.

  • Nanodiscs formation: Assemble protein into nanodiscs using membrane scaffold proteins (MSPs) and appropriate lipid compositions, providing a more native-like environment compared to detergent micelles.

  • Recombinant extracellular vesicles (rEVs): This emerging approach is particularly valuable, as demonstrated with other membrane proteins. rEVs allow the protein to be folded and inserted into native membranes using the cell's endogenous machinery, maintaining native conformations and membrane cofactors without requiring protein purification .

Cholesterol content appears particularly important for membrane protein interactions, as demonstrated by experiments using membrane-disrupting agents like Filipin III and methyl-β-cyclodextrin . Researchers should monitor the integrity of the reconstituted system using techniques such as dynamic light scattering and negative-stain electron microscopy.

What analytical techniques are most informative for characterizing bbp_256 structure and interactions?

Multiple complementary analytical approaches provide comprehensive characterization of bbp_256:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure composition

    • Differential scanning calorimetry to evaluate thermal stability

    • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Structural analysis:

    • Cryo-electron microscopy for near-atomic resolution structure determination

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map solvent-accessible regions

    • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) for distance measurements between domains

  • Interaction studies:

    • Biolayer interferometry (BLI) to evaluate binding kinetics with potential partners

    • Surface plasmon resonance (SPR) for quantitative binding measurements

    • Receptor-Display In Membranes Interaction Screen (RDIMIS) methodology, which has proven effective for membrane proteins that resist characterization by traditional methods

When studying potential interactions, researchers should consider both conventional approaches with recombinant ectodomains and membrane-context studies, as some interactions may only be detectable in the membrane environment due to requirements for specific lipid compositions or membrane structures .

How does bbp_256 compare structurally and functionally across different Buchnera aphidicola strains?

Comparative analysis of bbp_256 across different Buchnera aphidicola strains reveals important evolutionary adaptations reflecting the distinct host-symbiont relationships. The protein from B. pistaciae is particularly distinctive due to the unique membrane architecture of this strain. While Buchnera from Acyrthosiphon pisum and Schizaphis graminum possess a three-membraned system, B. pistaciae has evolved a double membrane system with the consequent loss of all outer-membrane integral proteins .

This membrane architecture difference likely impacts the functional role and structural organization of bbp_256 in B. pistaciae compared to its homologs in other strains. Sequence alignment of bbp_256 homologs across Buchnera strains reveals conserved transmembrane domains with variability in connecting loops, suggesting evolutionary pressure to maintain core structural elements while allowing adaptation of surface-exposed regions to different host environments.

What insights can be gained from studying bbp_256 in the context of Buchnera's evolution as an obligate symbiont?

The study of bbp_256 provides a window into the broader evolutionary trajectory of Buchnera as an obligate symbiont. Buchnera aphidicola has maintained a 150+ million-year association with aphids, enabling these insects to subsist exclusively on phloem sap . This long-term symbiotic relationship has driven extensive genome reduction and specialization.

In this context, bbp_256 exemplifies how membrane proteins have adapted to the unique metabolic interdependencies between host and symbiont. Transport functions in Buchnera have been shaped by distinct selective constraints occurring in different aphid lineages . The protein likely participates in the specialized transport system that has evolved in Buchnera, characterized by low transporter diversity compared to free-living bacteria and reliance on a few general transporters, some of which have potentially lost their substrate specificity .

The retention of bbp_256 despite extensive genome reduction suggests it serves an essential function in the symbiotic relationship, potentially in the exchange of metabolites between the bacterium and host cytoplasm. Comparative analysis across different Buchnera strains can reveal how selection pressures related to different host feeding habits have shaped this protein's evolution.

What is the phylogenetic distribution of the UPF0259 protein family and how conserved is the bbp_256 sequence?

The UPF0259 protein family, to which bbp_256 belongs, has a distribution primarily limited to proteobacteria, with greatest representation among γ-proteobacteria. This family represents an understudied group of membrane proteins, with the "UPF" (Uncharacterized Protein Family) designation indicating limited functional characterization.

Sequence conservation analysis reveals:

  • Core transmembrane domains: Highly conserved across family members, suggesting structural importance

  • Loop regions: More variable, potentially reflecting adaptation to specific cellular environments

  • Charged residues: Several charged amino acids in transmembrane-adjacent regions show conservation, suggesting roles in protein orientation or function

The bbp_256 sequence from B. pistaciae shows moderate sequence identity (approximately 65-75%) with homologs from other Buchnera strains, reflecting the divergence that has occurred during co-evolution with different aphid hosts. The higher conservation in transmembrane regions compared to connecting loops suggests functional constraints on membrane-spanning domains while allowing adaptation of exposed regions.

What hypotheses exist regarding the specific transport function of bbp_256 in Buchnera's membrane system?

Several hypotheses regarding the transport function of bbp_256 have emerged from comparative genomic analyses of Buchnera strains:

  • General transporter hypothesis: bbp_256 may function as one of the few general transporters that Buchnera relies on, potentially with reduced substrate specificity compared to its ancestral function . This is consistent with the observation that Buchnera transport systems have evolved toward low transporter diversity with reliance on generalized transport mechanisms.

  • Metabolite exchange hypothesis: Given the obligate symbiotic relationship between Buchnera and aphids, bbp_256 may participate in the exchange of essential metabolites between the symbiont and host. This could include the transport of amino acids synthesized by Buchnera or the import of host-derived nutrients.

  • Membrane integrity hypothesis: Rather than a direct transport role, bbp_256 might contribute to membrane structure and integrity in the unique double membrane system of B. pistaciae Buchnera.

The astonishing lack of inner-membrane importers observed across Buchnera strains suggests that any transport function of bbp_256 would likely be specialized to meet the unique constraints of the symbiotic lifestyle.

How can researchers design experiments to elucidate the substrate specificity of bbp_256?

To determine the substrate specificity of bbp_256, researchers should implement a multi-faceted experimental approach:

  • Reconstitution in proteoliposomes for transport assays:

    • Incorporate purified bbp_256 into liposomes

    • Test transport of radiolabeled or fluorescently labeled potential substrates

    • Measure uptake/efflux kinetics for various metabolites, including amino acids, sugars, and ions

  • Binding assays with candidate substrates:

    • Use isothermal titration calorimetry (ITC) to measure binding affinities

    • Employ microscale thermophoresis (MST) to detect interactions with small molecules

    • Develop fluorescence-based binding assays using environmentally sensitive fluorophores

  • Genetic approaches in model systems:

    • Heterologous expression in E. coli transport-deficient strains

    • Complementation assays to identify functional rescue

    • Site-directed mutagenesis of conserved residues to identify those critical for substrate recognition

  • RDIMIS platform application:

    • Adapt the Receptor-Display In Membranes Interaction Screen to identify potential interaction partners

    • Use rEVs displaying bbp_256 to screen against metabolite libraries

These approaches should be complemented with computational analyses, including homology modeling, molecular docking, and molecular dynamics simulations to predict substrate binding sites and transport mechanisms.

What is known about the relationship between bbp_256 and the unique double membrane system in Buchnera from B. pistaciae?

The relationship between bbp_256 and the unique double membrane system in Buchnera from B. pistaciae represents an intriguing evolutionary adaptation. Unlike Buchnera strains from A. pisum and S. graminum that maintain a three-membraned system, B. pistaciae Buchnera has evolved a double membrane structure with the consequent loss of all outer-membrane integral proteins .

This architectural difference has several implications for bbp_256:

  • Altered topological constraints: The loss of the outer membrane likely changes the topological constraints on membrane proteins, potentially affecting the orientation and function of bbp_256.

  • Modified transport pathways: The simplified membrane system may necessitate different transport mechanisms, with bbp_256 potentially adopting functions that compensate for the loss of outer membrane transporters.

  • Direct host-symbiont interface: In the double membrane system, bbp_256 may be positioned at a more direct interface between host and symbiont, potentially facilitating more immediate metabolite exchange.

The protein's retention in this streamlined membrane system suggests it plays an essential role in the symbiotic relationship. Transmission electron microscopy and confocal microscopic analysis of membrane organization and pH fields could provide insights into how bbp_256 is integrated into this unique membrane architecture .

How can the RDIMIS platform be adapted for studying bbp_256 interactions in membrane contexts?

The Receptor-Display In Membranes Interaction Screen (RDIMIS) platform offers significant advantages for studying bbp_256 interactions in membrane contexts, particularly given the challenges associated with membrane protein characterization. To adapt RDIMIS specifically for bbp_256 research:

  • rEV production strategy:

    • Generate HIV gag-containing recombinant extracellular vesicles (rEVs) expressing bbp_256

    • Create both full-length bbp_256 constructs and glycoprotein D (gD)-tagged ectodomain with GPI anchor variants

    • Validate expression and proper membrane incorporation using anti-His or gD antibodies

  • Screening library preparation:

    • Develop a comprehensive library of single-pass transmembrane (STM) ectodomains from potential interaction partners

    • Include proteins from the aphid host to identify potential host-symbiont interactions

    • Consider specialized sub-libraries focusing on transport-related proteins

  • Interaction detection optimization:

    • Employ biolayer interferometry (BLI) to detect binding between bbp_256-displaying rEVs and immobilized candidate partners

    • Implement cell-based binding assays to validate interactions in cellular contexts

    • Use fluorescence-based detection methods for high-throughput screening

  • Membrane composition analysis:

    • Assess the role of membrane cholesterol in bbp_256 interactions using cholesterol-disrupting reagents like Filipin III and methyl-β-cyclodextrin

    • Evaluate the impact of different lipid compositions on interaction strength and specificity

This approach is particularly valuable for bbp_256, as it allows the protein to maintain its native conformation in the membrane context, potentially revealing interactions that would be missed using purified recombinant proteins alone .

What are the challenges in studying membrane-dependent protein interactions for bbp_256 and how can they be addressed?

Studying membrane-dependent protein interactions for bbp_256 presents several significant challenges:

  • Protein purification limitations:

    • Difficulty maintaining native conformation during solubilization

    • Low expression yields common with membrane proteins

    • Potential misfolding during reconstitution

  • Membrane complexity factors:

    • Requirement for specific lipid compositions

    • Role of membrane cholesterol in protein function

    • Potential need for additional membrane cofactors

  • Methodological constraints:

    • Traditional interaction assays often fail with membrane proteins

    • Difficulty distinguishing specific from non-specific interactions

    • Limited sensitivity for weak or transient interactions

These challenges can be addressed through:

  • Membrane-mimetic systems:

    • Use of recombinant extracellular vesicles (rEVs) that maintain native membrane context

    • Application of nanodiscs with controlled lipid composition

    • Development of supported lipid bilayers for surface-based techniques

  • Advanced biophysical approaches:

    • Single-molecule techniques to detect transient interactions

    • In-membrane fluorescence resonance energy transfer (FRET)

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for conformational analysis

  • Computational methods:

    • Molecular dynamics simulations of bbp_256 in membrane environments

    • Prediction of interaction interfaces based on evolutionary conservation

    • Virtual screening of potential binding partners

The RDIMIS platform provides a particularly valuable approach, as it has demonstrated success in identifying interactions that are undetectable using traditional methods with purified proteins .

How might insights from bbp_256 contribute to understanding broader principles of membrane protein evolution in obligate symbionts?

Research on bbp_256 offers a valuable window into fundamental principles governing membrane protein evolution in obligate symbionts:

  • Reductive evolution mechanisms:

    • bbp_256 exemplifies how essential membrane proteins are retained despite extensive genome reduction

    • Analysis of sequence conservation patterns reveals which functional domains face strongest selection pressure

    • Comparison across Buchnera strains illuminates how membrane proteins adapt to different host environments

  • Functional specialization principles:

    • bbp_256 may demonstrate how general transporters evolve altered substrate specificities in symbiotic contexts

    • The protein's retention suggests it fulfills essential functions in metabolite exchange that cannot be provided by host transporters

    • Study of its function contributes to understanding how minimal transport systems can support obligate symbiosis

  • Membrane architecture adaptation:

    • The protein's presence in B. pistaciae's unique double membrane system provides insights into how membrane proteins adapt when membrane architecture is simplified

    • Analysis of bbp_256 topology and orientation may reveal principles governing protein integration in evolutionarily reduced membrane systems

    • Comparative study across strains with different membrane organizations helps elucidate constraints on membrane protein evolution

  • Host-symbiont interface evolution:

    • bbp_256 likely functions at the critical interface between host and symbiont

    • Understanding its role could reveal mechanisms ensuring specificity in metabolite exchange

    • Analysis of sequence variation might identify regions involved in host-specific adaptations

These insights extend beyond Buchnera to inform our understanding of membrane protein evolution in other obligate symbiotic systems, including mitochondria and chloroplasts, which represent the endpoint of symbiont integration.

Table 1: Key Characteristics of bbp_256 Membrane Protein

FeatureDescriptionReference
Protein nameUPF0259 membrane protein bbp_256
OrganismBuchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Protein length250 amino acids
Cellular locationCell membrane; Multi-pass membrane protein
Protein familyUPF0259 family
Expression systemin vitro E. coli expression system
Protein tagN-terminal 10xHis-tagged
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Membrane systemUnique double membrane system (vs. three-membraned in other strains)

Table 2: Comparative Features of Membrane Systems Across Buchnera Strains

Buchnera StrainHostMembrane SystemOuter Membrane ProteinsTransport CharacteristicsReference
B. pistaciaeBaizongia pistaciaeDouble membraneLost all outer-membrane integral proteinsSpecialized transport system
A. pisumAcyrthosiphon pisumThree-membranedPresentSimilar sets of transporters for most compound classes
S. graminumSchizaphis graminumThree-membranedPresentSimilar sets of transporters for most compound classes
C. cedriCinara cedriThree-membranedPresentExtremely poor repertoire of transporters, almost no ATP-driven active transport

Table 3: Recommended Experimental Approaches for bbp_256 Characterization

Research ObjectiveRecommended TechniquesAdvantagesConsiderationsReference
Protein-protein interactionsRDIMIS platformMaintains membrane context, High sensitivity for membrane-dependent interactionsRequires specialized equipment
Substrate transportProteoliposome reconstitutionDirect measurement of transport functionRequires optimization of reconstitution conditions-
Structural analysisCryo-electron microscopyNear-atomic resolution in membrane environmentTechnically challenging, requires high protein purity-
Membrane integrationConfocal microscopy with pH sensorsAnalyzes protein orientation in membranesRequires fluorescent labeling strategies
Evolution analysisComparative genomicsReveals selective pressures across symbiont lineagesDepends on genome sequence availability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.