Recombinant Buchnera aphidicola subsp. Schizaphis graminum ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Genetic Context and Operon Organization

The atpB gene is part of the atpBEFHAGDC operon in B. aphidicola, a structure conserved across γ-proteobacteria but distinct from organelle genomes . Notably, B. aphidicola lacks atpI (a gene upstream of atpB in E. coli) and regulatory systems like two-component response regulators or sigma factors, reflecting its streamlined genome .

Key Features of the atp Operon in B. aphidicola:

FeatureDescriptionSource
Gene OrderatpBEFHAGDC (identical to E. coli)
Transcription UnitSingle polycistronic operon (confirmed by RT-PCR)
Regulatory ElementsAbsent (no promoter/terminator sequences, attenuation systems)

Functional Role in Symbiosis

As part of the F₀F₁-ATP synthase, atpB facilitates ATP synthesis by coupling proton translocation across the inner membrane. This process is vital for B. aphidicola’s survival, as it provides energy for essential amino acid biosynthesis and other metabolic processes . The absence of alternative energy pathways in Buchnera (e.g., anaerobic respiration) underscores the critical role of this enzyme .

Functional Implications:

  • Proton Gradient Utilization: Drives ATP production under aerobic conditions .

  • Host Dependency: B. aphidicola’s reliance on ATP synthase highlights its obligate endosymbiotic lifestyle .

Research Applications

The recombinant atpB protein is used in:

  • SDS-PAGE: To verify protein purity and molecular weight .

  • ELISA: For quantification and antibody development (e.g., CSB-EP015070BXE1-B) .

  • Structural Studies: To investigate ATP synthase assembly and proton transport mechanisms .

Table 2: Applications and Methodologies

ApplicationMethodologyOutcomeSource
Purity AssessmentSDS-PAGE (Coomassie staining)>90% purity confirmation
Immune DetectionELISA (antibody-based quantification)Protein abundance measurement
Functional StudiesProton gradient-driven ATP synthesis assaysEnzyme activity characterization

Evolutionary and Biotechnological Significance

  • Genome Reduction: B. aphidicola’s streamlined genome (~640 kb) lacks non-essential genes, making ATP synthase indispensable .

  • Protein Stability: Recombinant production compensates for B. aphidicola’s inability to regulate gene expression .

  • Host-Symbiont Dynamics: Variations in Buchnera density correlate with aphid host plant adaptation, suggesting ATP synthase’s role in metabolic flexibility .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your needs.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you require a specific tag type, please inform us, and we will prioritize its development accordingly.
Synonyms
atpB; BUsg_002; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
atpB
Target Protein Sequence
MSLEKISNPQKYISHHLNHLQIDLCNFKFVEPGKIVSHFWVLNIDSIIFSLVLGCFFLSI FYTVAKKITTGVPNGLQASIELIFDFIRSNVKSMYQGKNPLIAPLSLTVFVWVFLMNLMD LIPIDFFPFISERFFHFPAMRIVPSADINITLSMSLGVFILILFYSVKMKGLIGFCKELT LQPFNHPVFFIFNFLLELVSLLSKPISLGLRLFGNMYSGEMIFILIAGLLPWWSQFFLNV PWAIFHILIISLQAFIFMVLTIVYLSMASQSH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of atpB in Buchnera aphidicola?

ATP synthase subunit a (atpB) in Buchnera aphidicola is a critical component of the F0 sector of ATP synthase, which forms a proton channel embedded in the inner membrane. This protein plays an essential role in energy production for this obligate endosymbiont. As Buchnera has evolved as an intracellular symbiont of aphids, its ATP synthase represents one of the core metabolic functions maintained despite extensive genome reduction. The maintenance of atpB in the Buchnera genome reflects its essential role in the bacterium's ability to produce ATP, which may contribute to the symbiotic relationship with its aphid host . The protein is especially significant given that Buchnera has lost many genes during its evolution as an endosymbiont but has retained this fundamental energy-generating capability.

What expression systems are most effective for producing recombinant Buchnera atpB?

E. coli expression systems are the preferred platform for recombinant Buchnera atpB production, primarily because of their ease of manipulation and the phylogenetic relationship between E. coli and Buchnera (both being gamma-proteobacteria) . When expressing Buchnera proteins, researchers should consider codon optimization to account for the high AT content in Buchnera genes. Cold-shock expression systems or those with reduced expression rates may help prevent the formation of inclusion bodies, which are common when expressing membrane proteins like atpB. The addition of an N-terminal His-tag has proven effective for purification purposes without significantly affecting protein structure . Expressing the protein in the presence of specific membrane-mimicking environments or using specialized E. coli strains (C41/C43) developed for membrane protein expression may improve yields and proper folding.

What are the optimal conditions for purifying recombinant Buchnera atpB?

Purification of recombinant Buchnera atpB requires consideration of its membrane protein nature. The optimal protocol involves:

  • Cell lysis under mild conditions (typically using detergent mixes like n-dodecyl-β-D-maltoside at 1-2%)

  • Initial purification using immobilized metal affinity chromatography (IMAC) with Ni-NTA resin, utilizing the His-tag

  • Secondary purification via size exclusion chromatography

  • Buffer optimization containing appropriate detergent concentrations (0.05-0.1%) to maintain protein solubility

The recommended storage conditions include Tris/PBS-based buffer with 6% trehalose at pH 8.0 . Post-purification, the protein should be kept at -20°C/-80°C with 50% glycerol added to prevent freeze-thaw damage. Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Notably, repeated freeze-thaw cycles significantly decrease protein activity and should be avoided; working aliquots may be stored at 4°C for up to one week.

What analytical techniques are most informative for characterizing recombinant Buchnera atpB structure and function?

For comprehensive characterization of recombinant Buchnera atpB, researchers should employ multiple complementary techniques:

  • Structural Analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Limited proteolysis combined with mass spectrometry to identify stable domains

    • Cryo-electron microscopy for integration into ATP synthase complex

  • Functional Analysis:

    • Proton translocation assays using reconstituted liposomes

    • ATP synthesis activity when co-assembled with other ATP synthase subunits

    • Patch-clamp electrophysiology to characterize the proton channel function

  • Interaction Studies:

    • Blue Native PAGE to assess complex assembly with other ATP synthase subunits

    • Crosslinking studies to identify proximity relationships within the complex

    • Surface plasmon resonance to measure binding affinities with other subunits

When interpreting data, researchers should consider the evolutionary context of Buchnera as an obligate endosymbiont with potential adaptations in its energy generation system compared to free-living bacteria.

How can researchers overcome the challenges of functional reconstitution of Buchnera atpB?

Functional reconstitution of membrane proteins like Buchnera atpB presents significant challenges. A methodological approach should include:

  • Detergent Selection: Systematic screening of detergents for optimal extraction and stability, beginning with mild detergents like DDM, LMNG, or digitonin.

  • Lipid Environment: Reconstitution into nanodiscs or liposomes composed of E. coli lipids or synthetic mixtures mimicking Buchnera membrane composition. The specific lipid composition significantly affects ATP synthase assembly and function.

  • Co-expression Strategies: Co-expressing atpB with other Buchnera ATP synthase subunits may improve stability and folding. Given the complex architecture of ATP synthase (as described in mitochondrial ATP synthase studies), co-expression with immediately adjacent subunits is particularly beneficial .

  • Assembly Verification: Use techniques such as size-exclusion chromatography, analytical ultracentrifugation, and native gel electrophoresis to verify proper assembly of the protein into functional complexes.

  • Functional Assays: Implement proton gradient-driven ATP synthesis measurements using pH-sensitive fluorescent dyes in reconstituted liposomes with appropriate controls.

The success of functional reconstitution can be significantly improved by incorporating lessons from the proposed assembly pathway of ATP synthase, which involves distinct modules forming the complete complex .

How does the evolution of Buchnera aphidicola affect the structure and function of its atpB?

The evolution of Buchnera aphidicola as an obligate endosymbiont has significantly influenced its atpB structure and function. Comparative genomic studies reveal that while Buchnera has undergone substantial genome reduction, ATP synthase genes remain relatively conserved across different aphid host species . This conservation highlights the essential nature of energy production for the endosymbiont.

The evolutionary trajectory of Buchnera has resulted in:

This evolutionary context suggests that recombinant Buchnera atpB may have unique structural features adapted to its endosymbiotic lifestyle, which should be considered when designing experiments.

What is the relationship between Buchnera atpB expression and endosymbiont density regulation in aphids?

The expression of Buchnera atpB must be considered within the context of the unique symbiotic relationship between Buchnera and its aphid host. Rather than regulating individual gene expression extensively, evidence suggests that aphids may control Buchnera population density as an adaptive response to environmental changes . This regulation mechanism has several implications for atpB function:

This complex relationship suggests that studies of recombinant atpB should consider the physiological context of varying symbiont densities and host-derived regulatory mechanisms.

How might Buchnera atpB interact with aphid host factors in the bacteriocyte environment?

The bacteriocyte environment represents a specialized niche where Buchnera proteins, including atpB, may engage in unique interactions with host factors. While direct evidence for atpB-specific interactions is limited, the following interactions can be hypothesized based on available data:

  • Membrane Interface Adaptations: Given the intimate association between Buchnera and the bacteriocyte, the atpB protein may have adapted to function in proximity to host-derived membranes or membrane proteins.

  • Transcription Factor Regulation: The aphid transcription factors expressed during bacteriocyte development may indirectly influence Buchnera atpB expression or function through host-symbiont signaling cascades.

  • Metabolic Integration: ATP produced by Buchnera ATP synthase likely supports essential amino acid synthesis, particularly tryptophan synthesis involving the plasmid-encoded TrpEG , forming an integrated metabolic network with host metabolism.

  • Ion Homeostasis: Host factors may regulate the ionic environment of bacteriocytes, potentially affecting the proton gradient necessary for atpB function in ATP synthesis.

Experimental approaches to investigate these interactions could include co-immunoprecipitation studies using recombinant atpB with bacteriocyte lysates, or proximity labeling techniques to identify proteins in close association with atpB in intact bacteriocytes.

What techniques can determine if recombinant Buchnera atpB retains native structure and function?

Verifying that recombinant Buchnera atpB maintains its native structure and function requires a multi-faceted approach:

Structural Validation Methods:

TechniqueApplicationExpected Outcome
Circular Dichroism (CD)Secondary structure analysisAlpha-helical content consistent with membrane protein structure
Limited ProteolysisDomain stability assessmentProteolytic pattern reflecting transmembrane domain protection
Thermal Shift AssaysProtein stability assessmentMelting temperature profile indicating proper folding
Native Mass SpectrometryOligomeric state analysisDetection of appropriate subunit interactions when co-expressed with other ATP synthase components

Functional Validation Methods:

TechniqueApplicationExpected Outcome
Proton Translocation AssaysChannel function assessmentpH-dependent fluorescence changes in reconstituted systems
ATP Synthesis ActivityEnzymatic function measurementATP production when incorporated into a complete ATP synthase complex
Inhibitor Binding StudiesActive site verificationSpecific binding of known ATP synthase inhibitors
ElectrophysiologyChannel conductance propertiesCharacteristic conductance profiles similar to other bacterial ATP synthase subunit a proteins

Researchers should note that full functional validation might require co-expression with other ATP synthase subunits, as atpB alone would not catalyze ATP synthesis but contributes to the proton channel component of the complex .

What are the critical experimental controls when studying recombinant Buchnera atpB?

When conducting experiments with recombinant Buchnera atpB, the following critical controls should be implemented:

  • Expression System Controls:

    • Empty vector control to differentiate host cell background

    • Expression of a known membrane protein with similar complexity (positive control)

    • Comparison with denatured atpB samples (negative control)

  • Purification Controls:

    • Sequential elution samples to verify purity

    • Western blot confirmation using both anti-His and anti-atpB antibodies where available

    • Mock purification from non-transformed cells to identify non-specific binding contaminants

  • Functional Assay Controls:

    • Heat-inactivated protein samples to confirm activity is protein-dependent

    • Site-directed mutants of critical residues to verify structure-function relationships

    • Competitive inhibition with known ATP synthase inhibitors

    • pH gradient dissipation controls in reconstituted systems

  • Specificity Controls:

    • Comparison with recombinant atpB from closely related bacteria

    • Competition assays with unlabeled protein in binding studies

    • Isothermal titration calorimetry (ITC) with known interaction partners

These controls help differentiate specific atpB activities from artifacts and non-specific effects, ensuring reliable and reproducible research outcomes.

What are the potential applications of recombinant Buchnera atpB in understanding endosymbiont-host interactions?

Recombinant Buchnera atpB offers several promising applications for investigating endosymbiont-host interactions:

  • Energy Metabolism Mapping: Using recombinant atpB in reconstituted systems can help quantify ATP production capacity under different conditions, providing insights into the energetic contribution of Buchnera to aphid metabolism.

  • Host Adaptation Studies: Comparing atpB proteins from Buchnera strains associated with different aphid species could reveal host-specific adaptations in energy production mechanisms .

  • Symbiosis Evolution Research: Structure-function studies of atpB could illuminate how this essential protein has adapted during the long co-evolutionary history of Buchnera and aphids, potentially revealing principles applicable to other endosymbiotic systems.

  • Synthetic Biology Applications: Understanding atpB could contribute to designing minimal ATP synthase complexes for synthetic biology applications or engineered symbionts.

  • Bacteriocyte Interaction Models: Recombinant atpB could be used to identify potential interaction partners from the host bacteriocyte, helping map the molecular interface between endosymbiont and host cell .

These applications could significantly advance our understanding of the molecular foundations of obligate endosymbiosis and the adaptations that enable long-term stable symbiotic relationships.

How might studying Buchnera atpB contribute to understanding bacterial ATP synthase evolution?

Investigating Buchnera atpB provides a unique window into ATP synthase evolution under the constraints of an obligate endosymbiotic lifestyle:

  • Minimal Functional Requirements: The reduced Buchnera genome maintains only essential components of ATP synthase, helping identify the minimal requirements for functional ATP synthesis in a specialized niche.

  • Evolutionary Rate Analysis: Comparing substitution rates in atpB across Buchnera strains from different aphid lineages can reveal patterns of selection pressure on different functional domains .

  • Host-Driven Adaptations: Identifying unique features of Buchnera atpB compared to free-living bacteria may reveal adaptations driven by the host environment or metabolic integration requirements.

  • Convergent Evolution Assessment: Comparison with ATP synthase components from other endosymbionts (such as Wolbachia or Carsonella) could reveal patterns of convergent evolution under similar selective pressures.

  • Ancestral State Reconstruction: Using the phylogenetic relationships between Buchnera strains and their atpB sequences allows inference of ancestral states and evolutionary trajectories of this critical energy-generating complex.

This research direction could contribute significantly to understanding how essential cellular machinery adapts during the transition from free-living to endosymbiotic lifestyles while maintaining core functionality.

What are common challenges in the expression and purification of recombinant Buchnera atpB?

Researchers working with recombinant Buchnera atpB frequently encounter several technical challenges:

ChallengeCausePotential Solution
Low expression yieldHigh AT content of Buchnera genes affecting translation efficiencyCodon optimization for expression host; use special strains designed for AT-rich genes
Inclusion body formationMembrane protein overexpression overwhelming cellular machineryReduce expression temperature (16-20°C); use specialized E. coli strains (C41/C43); add fusion partners (MBP, SUMO)
Protein insolubilityHydrophobic transmembrane domainsOptimize detergent screening (start with DDM, LMNG, or digitonin); include lipids during extraction
Protein instabilityLack of interaction partners normally present in BuchneraCo-express with other ATP synthase subunits; add stabilizing agents like glycerol or specific lipids
Purification inconsistencyVariability in membrane protein extractionStandardize biomass:detergent ratios; implement rigorous quality control checkpoints during purification
Loss of activityDenaturation during purification or storageAvoid harsh elution conditions; minimize time outside of stabilizing buffer; add antioxidants to prevent oxidative damage

Implementation of a systematic optimization strategy addressing each of these challenges sequentially can significantly improve research outcomes when working with this challenging protein.

How can researchers verify that recombinant Buchnera atpB faithfully represents the native protein?

Ensuring that recombinant Buchnera atpB accurately represents the native protein requires a comprehensive validation strategy:

  • Sequence Verification:

    • Complete DNA sequencing of the expression construct

    • Mass spectrometry analysis of the purified protein to confirm sequence integrity

    • Terminal sequencing to verify absence of unexpected truncations

  • Structural Validation:

    • Secondary structure analysis using circular dichroism compared with theoretical predictions

    • Limited proteolysis patterns indicating proper domain folding

    • Thermal stability profiles consistent with a well-folded membrane protein

  • Functional Comparisons:

    • Ability to complement ATP synthase deficient systems when appropriate

    • Characteristic response to known ATP synthase inhibitors

    • Proton translocation capabilities in reconstituted systems

  • Interaction Validation:

    • Ability to associate with other ATP synthase subunits from Buchnera or related bacteria

    • Blue Native PAGE migration patterns consistent with proper complex formation

    • Binding affinity measurements with known interaction partners

  • Environmental Sensitivity:

    • pH-dependent stability and activity profiles

    • Response to physiologically relevant ion concentrations

    • Lipid composition effects on protein stability and function

The most rigorous validation would involve comparing the recombinant protein with native Buchnera atpB isolated directly from bacteriocytes, though this presents significant technical challenges given the obligate intracellular nature of Buchnera.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.