Recombinant Buchnera aphidicola subsp. Schizaphis graminum ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
atpF; BUsg_004; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
atpF
Target Protein Sequence
MNLNATILGQALSFILFVWFCMKYIWPPIIFAIETRQKNIEESLISLKKAEEELIIIQKK MNQIIQDSKEKASFIINEANKKKSIILEDAKSIALEESKKIFLRNQLEIDLKVMQVRKNL HKEIVDLSILIAEKIIKDNIQKDQYKYSIKKLIVSLSKDKKLI
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, connected by a central and peripheral stalk. ATP synthesis in the F(1) domain's catalytic site is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk that links F(1) and F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the genomic organization of ATP synthase genes in Buchnera aphidicola from Schizaphis graminum?

Table 1: Comparison of ATP synthase gene organization between B. aphidicola and related organisms

OrganismGene OrderLocationSpecial Features
B. aphidicolaatpBEFHAGDCSingle operonLacks atpI gene
E. coliatpIBEFHAGDCSingle operonIncludes atpI gene
MitochondriaVariesSplit between organellar and nuclear genomePartitioned gene organization
ChloroplastsVariesSplit between organellar and nuclear genomePartitioned gene organization

How does atpF gene structure in Buchnera aphidicola contribute to ATP synthesis?

The atpF gene encodes the b subunit of the F₀ sector of ATP synthase, which forms a critical part of the stator that connects the F₁ and F₀ portions of the enzyme complex. In Buchnera aphidicola, this gene is particularly important as the organism utilizes a proton gradient for the generation of ATP . The detection of genes encoding the ATP synthase (including atpF) and observations indicating that B. aphidicola is capable of respiration confirm that this endosymbiont employs oxidative phosphorylation despite its reduced genome .

What challenges exist in cloning and expressing recombinant Buchnera aphidicola atpF?

Cloning and expressing recombinant proteins from Buchnera aphidicola presents several unique challenges:

  • Genomic isolation difficulties: As an obligate intracellular symbiont, B. aphidicola cannot be cultured independently, making DNA isolation more complex .

  • Codon usage bias: B. aphidicola has a strong AT-bias in its genome, resulting in codon usage patterns that differ from common expression hosts. Studies show that in Buchnera, there is a significant codon usage bias for rare codons - C-ending codons are preferred in highly expressed genes, whereas G-ending codons are avoided .

  • Expression optimization: Recombinant expression often requires specialized approaches, including the use of fusion tags such as TAT-HA (trans-activator of transduction-hemagglutinin), 6×His and fluorescent proteins like EGFP or mCherry .

  • Protein folding challenges: Membrane proteins like ATP synthase subunit b often face folding and solubility issues in heterologous expression systems.

A recommended approach would be to use E. coli BL21(DE3) cells for protein production, followed by purification using immobilized metal affinity chromatography with a Ni-nitrilotriacetic acid column .

How can researchers verify the functionality of recombinant atpF?

To verify the functionality of recombinant atpF protein, researchers can employ several complementary approaches:

  • ATP synthesis assays: Reconstitute the recombinant atpF with other ATP synthase subunits in liposomes and measure ATP production under varying proton gradient conditions.

  • Structural analysis: Use circular dichroism spectroscopy to assess proper folding of the recombinant protein.

  • Binding assays: Evaluate the ability of atpF to interact with other ATP synthase subunits using co-immunoprecipitation or surface plasmon resonance.

  • Complementation studies: Attempt to complement E. coli atpF mutants with the Buchnera atpF gene to assess functional conservation.

  • Fluorescence microscopy: If tagged with fluorescent proteins like EGFP or mCherry, visualize proper localization to membranes when expressed in host cells .

What is known about atpF conservation across different Buchnera strains?

While the search results don't provide specific information about atpF conservation across different Buchnera strains, several inferences can be made based on the evolutionary patterns of Buchnera genomes:

The conservation of the entire ATP synthase operon (atpBEFHAGDC) in the highly reduced genome of Buchnera suggests strong selective pressure to maintain these genes . As an essential component of energy metabolism, atpF likely shows high sequence conservation in functionally critical domains across different Buchnera strains.

The analysis of Buchnera's operon map structure indicates that selection pressure is maintained on gene conservation for genes requiring specific transcription regulation . Since ATP synthesis is fundamental to cellular function, atpF would be expected to be among the more conserved genes in the Buchnera genome.

How does the transcriptional regulation of atpF differ in Buchnera compared to free-living bacteria?

Transcriptional regulation in Buchnera aphidicola shows distinct patterns compared to free-living bacteria due to its reduced genome and evolutionary history:

  • Operon structure: Research indicates that B. aphidicola TUs (transcription units) contain more genes on average than those of E. coli (2.12 vs. 1.63 genes) . The atpF gene, as part of the atpBEFHAGDC operon, exemplifies this trend toward polycistronic organization.

  • Limited regulatory complexity: B. aphidicola appears to be evolving toward a more polycistronic operon map with relatively weak selection pressure on specific transcription regulation . This suggests that atpF expression is primarily determined by its position within its operon rather than by specific regulatory mechanisms.

  • Evolutionary trajectory: The global layout of B. aphidicola's operon map was mainly shaped by reduction and rearrangement events that occurred early in the symbiosis . Current evolution seems limited to small reorganizations around the frontiers of transcription units, through promoter and/or terminator sequence modifications .

  • Selection pressure: Analysis shows that the need for specific transcription regulation exerts pressure on gene conservation but not on gene assembling in the operon map . This indicates that the presence of atpF is maintained by selection, but its specific arrangement within operons may be more flexible.

Table 2: Comparison of transcriptional features between B. aphidicola and E. coli

FeatureB. aphidicolaE. coli
Average TU length (genes)2.121.63
Average polycistronic TU length (genes)3.433.17
Evolutionary directionToward more polycistronic TUsMaintains balanced operon structure
Selection on intergenic regionsMaintained on length of regions between divergent gene pairsComplex regulation at intergenic regions

What methodologies are most effective for studying atpF expression in the context of the aphid-Buchnera symbiosis?

Studying gene expression in an obligate endosymbiont presents unique challenges that require specialized approaches:

  • Aphid-Buchnera system preparation:

    • Maintain aphid colonies under controlled conditions

    • Isolate Buchnera cells from aphid bacteriocytes through gentle homogenization and differential centrifugation

    • Extract RNA immediately to prevent degradation

  • Transcriptome analysis:

    • RNA-seq to quantify atpF expression levels under different conditions

    • RT-qPCR for targeted analysis of atpF and related genes

    • Apply Bayesian predictors as described in research to confirm transcription unit boundaries

  • Environmental stress studies:

    • Subject aphids to temperature variations similar to the methods used in the ibpA studies

    • Analyze atpF expression changes in response to nutritional stress on the host

    • Monitor both symbiont and host responses simultaneously

  • Advanced microscopy:

    • Fluorescence in situ hybridization (FISH) to visualize atpF expression within intact bacteriocytes

    • Combine with immunolocalization to correlate transcript and protein levels

  • Heterologous expression systems:

    • Create reporter constructs with the atpF promoter region to test in E. coli

    • Use protein transduction technology to introduce recombinant proteins into cultured cells

How do mutations in atpF impact symbiont fitness and aphid host biology?

While no studies directly examining atpF mutations in Buchnera are presented in the search results, research on other Buchnera genes provides valuable insights into potential impacts:

  • Energy metabolism effects: As atpF encodes a critical component of ATP synthase, mutations would likely impair ATP production, affecting Buchnera's metabolic capacity and potentially reducing its ability to synthesize nutrients for the aphid host.

  • Temperature sensitivity: Research has shown that mutations in Buchnera, specifically a single nucleotide deletion in the heat-shock transcriptional promoter for ibpA, dramatically affect host fitness in a temperature-dependent manner . Similar temperature-dependent effects might occur with atpF mutations.

  • Symbiont persistence: Severe mutations in energy production genes like atpF could reduce Buchnera populations within aphids, similar to observations where aphids bearing mutant symbionts contained almost no Buchnera after heat exposure .

  • Conditional fitness effects: Interestingly, under constant cool conditions, aphids containing symbionts with the ibpA promoter mutation reproduced earlier and maintained higher reproductive rates . This suggests that some mutations in Buchnera genes might have context-dependent effects on host fitness.

  • Field relevance: The ibpA short allele was found at appreciable frequencies in field populations (up to 20%) , suggesting that mutations in key Buchnera genes can persist in natural conditions when they provide conditional benefits.

What structural modifications enhance stability and functionality of recombinant atpF protein?

To optimize recombinant atpF protein production and functionality, several structural modifications can be implemented:

  • Fusion tags and expression systems:

    • TAT-HA tag for cell penetration and protein tracking

    • 6×His tag for purification using immobilized metal affinity chromatography

    • EGFP or mCherry fluorescent tags for visualization and monitoring

    • Production in E. coli BL21(DE3) cells with optimized induction conditions

  • Codon optimization strategies:

    • Account for Buchnera's codon usage bias, where C-ending codons are preferred in highly expressed genes

    • Consider the tRNA abundances in the expression host, as tRNA expression levels can change under stress conditions

  • Detergent and membrane mimetics:

    • Screen different detergents for optimal solubilization of this membrane protein

    • Consider nanodiscs or liposomes for maintaining native-like membrane environment

  • Stabilizing mutations:

    • Identify and modify regions prone to aggregation or degradation

    • Introduce disulfide bonds at strategic positions to enhance structural stability

    • Replace surface-exposed hydrophobic residues with charged or polar residues

How can atpF be used as a model to understand genome reduction in endosymbionts?

The atpF gene and the ATP synthase complex provide an excellent model for understanding genome reduction principles in endosymbionts:

  • Essentiality and retention: Despite extensive genome reduction in Buchnera (down to ~450-640 kb), the complete ATP synthase operon including atpF is retained . This highlights how essential metabolic functions resist the reductive evolutionary forces.

  • Operon structure evolution: The atpBEFHAGDC operon in Buchnera maintains the same gene order as in E. coli but lacks the atpI gene . This selective gene loss within operons provides insights into the minimal functional requirements of multi-protein complexes.

  • Transcriptional unit evolution: Research indicates that B. aphidicola is evolving toward a more polycistronic operon map, with TUs containing more genes than in E. coli . The ATP synthase operon exemplifies this trend toward gene clustering.

  • Codon usage patterns: Analysis of Buchnera shows significant codon usage bias influencing gene expression . Studying these patterns in atpF can reveal how translational efficiency is maintained despite genome-wide AT-bias.

  • Methodological approach:

    • Comparative genomics of atpF across multiple Buchnera strains

    • Analysis of selection pressures on different domains of the protein

    • Functional complementation studies to determine minimal functional requirements

    • Reconstruction of evolutionary trajectories through phylogenetic analysis

How to optimize recombinant atpF expression in E. coli?

For optimal expression of recombinant Buchnera aphidicola atpF in E. coli, the following methodological approach is recommended:

  • Vector design and cloning:

    • Design a synthetic gene with optimized codons for E. coli expression

    • Include fusion tags as described in research: TAT-HA, 6×His, and EGFP/mCherry

    • Clone into an expression vector with an inducible promoter (e.g., T7)

  • Expression optimization:

    • Transform into E. coli BL21(DE3) cells as recommended in protocols

    • Test multiple induction conditions (IPTG concentration, temperature, duration)

    • Consider specialized strains for membrane proteins (C41/C43)

  • Protein purification:

    • Use immobilized metal affinity chromatography (IMAC) with a Ni-nitrilotriacetic acid column

    • Include detergents appropriate for membrane proteins

    • Consider on-column refolding if inclusion bodies form

  • Verification methods:

    • SDS-PAGE coupled with western blotting for protein detection

    • Fluorescence microscopy if using EGFP or mCherry tags

    • Circular dichroism to assess secondary structure

Table 3: Optimization parameters for recombinant atpF expression

ParameterRecommended RangeNotes
Induction temperature16-30°CLower temperatures may improve folding
IPTG concentration0.1-1.0 mMTest multiple concentrations
Expression time4-24 hoursMonitor time course for optimal yield
Cell lysis bufferVariableInclude protease inhibitors and appropriate detergents
Purification conditions4°CMaintain cold chain to prevent aggregation

What techniques are available for functional characterization of atpF in the absence of a Buchnera culture system?

Since Buchnera aphidicola cannot be cultured independently, researchers must employ alternative approaches for functional characterization of atpF:

  • Heterologous expression and functional reconstitution:

    • Express and purify recombinant atpF and other ATP synthase subunits

    • Reconstitute into liposomes for functional studies

    • Measure ATP synthesis activity using luciferase-based assays

  • In vivo aphid-based approaches:

    • Analyze atpF expression in Buchnera within aphids under different conditions

    • Use RT-PCR to quantify transcript levels in response to environmental stressors

    • Apply aphid microinjection techniques for introducing experimental compounds

  • Comparative biochemistry:

    • Compare properties with well-characterized homologs from E. coli

    • Use E. coli deletion mutants complemented with Buchnera atpF

    • Analyze substrate specificity and catalytic parameters

  • Structural biology:

    • Use X-ray crystallography or cryo-EM to determine structure

    • Compare with known structures from model organisms

    • Identify unique features that may relate to Buchnera's symbiotic lifestyle

  • Protein transduction technology:

    • Utilize the TAT-HA tag system described in research to introduce recombinant proteins into mammalian cells for functional studies

    • Monitor localization and activity using fluorescent tags

How do codon usage patterns in atpF affect recombinant protein expression?

The codon usage patterns in Buchnera aphidicola have significant implications for recombinant expression of atpF:

  • Buchnera-specific codon bias:

    • Research shows that Buchnera has overcome its AT-rich mutational bias through specific codon selection

    • C-ending codons are preferred in highly expressed genes, whereas G-ending codons are avoided

    • This bias might correspond to selection for perfect matching between codon-anticodon pairs for essential amino acids

  • tRNA abundance effects:

    • Studies show that nutritional stress applied to the aphid host induced significant overexpression of most tRNA isoacceptors in Buchnera

    • This suggests that tRNA availability is a key factor in translation efficiency

  • Expression strategies:

    • Codon optimization for the expression host is critical

    • Consider the relative abundances of tRNAs in the expression system

    • Monitor for translational pausing or premature termination

Table 4: Codon usage comparison between Buchnera aphidicola and E. coli

Amino AcidPreferred Codon in BuchneraPreferred Codon in E. coliStrategy for Optimization
LeuUUA (AT-rich)CUG (GC-rich)Adjust for expression host
ArgAGA (AT-rich)CGU/CGC (GC-rich)Critical for proper folding
SerAGU/UCA (AT-rich)UCU/AGCMay affect translation rate
GlyGGA (higher A)GGC (higher C)Important for secondary structure
  • Experimental verification:

    • Compare expression levels and solubility of native vs. codon-optimized sequences

    • Analyze translation rates using ribosome profiling

    • Test effects of rare codon supplementation (e.g., using E. coli Rosetta strains)

What approaches can be used to study the integration of atpF into the ATP synthase complex?

Studying the integration of atpF (ATP synthase subunit b) into the complete ATP synthase complex requires specialized approaches due to the membrane-associated nature of this protein complex:

  • Co-expression strategies:

    • Co-express atpF with other subunits of the ATP synthase complex

    • Use polycistronic constructs mimicking the natural operon structure (atpBEFHAGDC)

    • Tag individual subunits differentially for tracking assembly

  • Membrane protein biochemistry:

    • Optimize detergent conditions for extraction of intact complexes

    • Use blue native PAGE to analyze complex formation

    • Apply cross-linking techniques to capture transient interactions

  • Microscopy approaches:

    • Utilize fluorescent protein fusions (EGFP/mCherry) as described in protocols

    • Perform FRET analysis to study subunit-subunit interactions

    • Use super-resolution microscopy to visualize complex formation in membranes

  • Mass spectrometry:

    • Apply native mass spectrometry to analyze intact complexes

    • Use hydrogen-deuterium exchange to map interaction surfaces

    • Perform cross-linking followed by MS to identify proximity relationships

  • Cryo-electron microscopy:

    • Visualize the entire ATP synthase complex

    • Compare structures with and without atpF

    • Map the exact position and conformation of atpF within the complex

How can the thermal stability of atpF be assessed and improved?

The thermal stability of atpF is particularly relevant given the known temperature-dependent effects of Buchnera mutations on aphid fitness . Several approaches can be employed to assess and improve thermal stability:

  • Thermal stability assessment methods:

    • Differential scanning calorimetry (DSC) to determine melting temperature

    • Circular dichroism (CD) to monitor secondary structure changes with temperature

    • Fluorescence-based thermal shift assays for high-throughput screening

    • Activity assays at different temperatures to assess functional thermal stability

  • Stabilization strategies:

    • Rational design based on structural comparison with thermophilic homologs

    • Introduction of disulfide bonds or salt bridges at strategic positions

    • Surface engineering to reduce hydrophobic patches

    • Directed evolution approaches selecting for thermostable variants

  • In vivo thermal tolerance studies:

    • Expose aphids containing Buchnera to different temperature regimes

    • Measure atpF expression and ATP synthase activity

    • Compare with the temperature-dependent effects observed for the ibpA mutation

  • Fusion tags for stability enhancement:

    • Test the effect of different fusion tags (MBP, SUMO, etc.) on thermal stability

    • Evaluate whether the TAT-HA and fluorescent protein tags described in protocols affect thermal properties

  • Formulation optimization:

    • Screen buffer components that enhance thermal stability

    • Test stabilizing additives (glycerol, trehalose, arginine)

    • Optimize pH and ionic strength for maximal stability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.