Recombinant Buchnera aphidicola subsp. Schizaphis graminum Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
clsA; cls; BUsg_262; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
clsA
Target Protein Sequence
MDIFYDLIKWLVVLIYWLLIANITYRILIKRRSIPSSMSWLLTIYIIPFIGIAIWFFFGE LYLGKRQKKIAKKIWSISNTYLNKLKSYKYIFQIKNSEVATSLFQLCKHRQGIYGIKNNK ITLLTNTQNTIEVLIRDIYSARNNIEMVFYIWKPGGIADDVAMALIDSAKRGVHCRLMLD SAGSVEFFRSPWFDIMKKSGIEIVEALKVSLIRIFLRRLDVRQHRKIILIDNYISYSGSM NLVDPYLFKQSSGVGQWIDLMTRIEGPVATAIGIIYSCDWEIETGFKILPKLPNKEMLKK KCNQNSSIQVIASGPGFPKNVIHQALLTAIYSARNELIMTTPYLVPSDDLLHAICTAAQR GVKVSIIIPLYHDSILVKWASRVFFSELLEAGVKIYQFKKGLLHSKSILIDQQLSLIGTV NLDMRSLWLNFEITLVIDDRKFSHHLSAIQKEYIDNSRLLDKNTWSMRAYWTRILEKIFY FLSPLL
Uniprot No.

Target Background

Function

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Cardiolipin synthase (cls) catalyzes the reversible transfer of a phosphatidyl group between phosphatidylglycerol molecules, producing cardiolipin (CL) (diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and why is it significant for research?

Buchnera aphidicola is a prokaryotic, obligately intracellular endosymbiont found in aphids, including Schizaphis graminum, and is essential for host survival . It belongs to the gamma-3 subdivision of the Proteobacteria class, which also includes Escherichia coli . The significance of this organism stems from its unique evolutionary position - molecular evidence indicates that the endosymbiotic association resulted from a single infection of an aphid ancestor approximately 200-250 million years ago . This long-term symbiotic relationship has led to genome reduction and metabolic interdependence with the host, making it an excellent model for studying endosymbiosis, genome evolution, and host-microbe interactions. Despite being an obligate endosymbiont, Buchnera maintains many properties of free-living bacteria rather than organelles .

What is the function of Cardiolipin synthase in Buchnera aphidicola?

Cardiolipin synthase (cls) in Buchnera aphidicola catalyzes the synthesis of cardiolipin, a key phospholipid component of bacterial membranes . This enzyme (EC 2.7.8.-) is responsible for creating the unique tetra-acylated structure of cardiolipin from phosphatidylglycerol precursors . In endosymbionts like Buchnera, cardiolipin is particularly important for maintaining membrane integrity and function within the specialized host environment. The protein's role extends beyond basic membrane structure, as cardiolipin is known to interact with numerous membrane proteins and is concentrated at cell division sites in bacteria. In the context of endosymbiosis, the maintenance of this gene despite genome reduction suggests its essential function for survival within host cells.

What are the optimal storage conditions for recombinant Buchnera aphidicola cls protein?

For optimal stability and activity of recombinant Buchnera aphidicola cls protein, storage at -20°C is recommended for routine use, while extended storage should be at -20°C or -80°C . The protein is typically supplied in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein . Working aliquots may be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can significantly compromise protein structure and function .

When handling the protein, researchers should implement a workflow that minimizes temperature fluctuations and exposure to proteases. For experiments requiring longer incubation periods, addition of protease inhibitors may be beneficial. Activity assays performed before and after storage periods can help establish the functional half-life of the prepared protein under laboratory conditions.

How can I verify the activity of recombinant cls protein in vitro?

Verification of recombinant cls protein activity requires assessing its enzymatic function in converting phosphatidylglycerol to cardiolipin. A standard activity assay involves:

  • Prepare a reaction mixture containing:

    • Purified recombinant cls protein (5-10 μg)

    • Phosphatidylglycerol substrate (100-200 μM)

    • Buffer system (typically Tris-HCl, pH 7.5-8.0)

    • Divalent cations (Mg²⁺ or Mn²⁺, 5-10 mM)

    • Reducing agent (DTT or β-mercaptoethanol, 1-5 mM)

  • Incubate the reaction at 30-37°C for 30-60 minutes

  • Extract lipids using chloroform:methanol (2:1) solvent system

  • Analyze the reaction products using:

    • Thin-layer chromatography (TLC) with appropriate phospholipid standards

    • Mass spectrometry for detailed molecular characterization

    • Phosphorus content analysis to quantify conversion rates

Activity can be expressed as nmol of cardiolipin formed per minute per mg of protein. Comparison with cls activity from model organisms like E. coli can provide a reference point for expected activity levels.

What expression systems are most effective for producing recombinant Buchnera aphidicola cls protein?

Given the challenges of working with proteins from obligate endosymbionts, several expression systems have been evaluated for producing recombinant Buchnera aphidicola proteins:

Expression SystemAdvantagesLimitationsTypical Yield
E. coli- Genetic similarity to Buchnera
- Rapid growth
- Well-established protocols
- Potential protein folding issues
- Possible toxicity
- Limited post-translational modifications
5-20 mg/L
Yeast (S. cerevisiae)- Eukaryotic folding machinery
- Better for membrane proteins
- Scalable production
- Slower growth
- Codon usage differences
- Hyperglycosylation concerns
2-10 mg/L
Insect cells- More natural environment
- Better folding for Buchnera proteins
- Appropriate post-translational modifications
- Higher cost
- More complex protocols
- Longer production time
1-5 mg/L
Cell-free systems- Rapid production
- Avoids toxicity issues
- Direct control of reaction environment
- Lower yields
- Higher cost
- Limited scale-up potential
0.5-2 mg/L

For cls specifically, E. coli expression systems using vectors with tightly regulated promoters (such as T7-based systems) and fusion tags to enhance solubility (such as SUMO, MBP, or TRX) often provide the best combination of yield and functional protein. Codon optimization for E. coli expression may be necessary due to the AT-rich genome of Buchnera aphidicola .

How does cls from Buchnera aphidicola differ structurally and functionally from its E. coli homolog?

Comparative analysis of Buchnera aphidicola cls with its E. coli homolog reveals important evolutionary adaptations. Based on genomic studies of Buchnera aphidicola, endosymbiont proteins typically show 47-80% amino acid sequence identity with their E. coli counterparts . For cls specifically, several key differences include:

  • Sequence conservation: Catalytic domains are generally more conserved than peripheral regions, reflecting functional constraints.

  • Membrane integration: Buchnera cls may have adapted its membrane-spanning regions to function within the specialized symbiont-containing vesicles (bacteriocytes) of the aphid host.

  • Regulatory elements: Similar to other Buchnera enzymes like CysE, the cls enzyme may lack some regulatory features found in free-living bacteria . This could reflect adaptation to the stable environment within the host and potentially constitutive expression patterns.

  • Substrate specificity: Potential differences in phospholipid composition between Buchnera and E. coli membranes may be reflected in subtle adaptations in the active site architecture of cls.

These differences highlight the evolutionary trajectory of Buchnera as it adapted to the endosymbiotic lifestyle, with possible implications for enzyme efficiency, regulation, and integration with host metabolism.

What role might cls play in the Buchnera-aphid symbiotic relationship?

The maintenance of cls in the highly reduced genome of Buchnera aphidicola suggests its critical importance in the symbiotic relationship. Several hypotheses regarding its role include:

  • Membrane stability: Cardiolipin provides structural integrity to bacterial membranes, potentially helping Buchnera survive within the specialized intracellular environment of aphid bacteriocytes.

  • Metabolic interface: Cardiolipin-rich membrane domains may facilitate the exchange of metabolites between Buchnera and its aphid host, similar to how cardiolipin functions in mitochondrial membranes.

  • Stress response: Cardiolipin composition can change in response to environmental stressors, potentially helping Buchnera adapt to fluctuations in the host physiological state.

  • Bacteriocyte recognition: The unique lipid composition of Buchnera membranes may play a role in host recognition and preventing activation of aphid immune responses.

  • Vertical transmission: Proper membrane composition may be essential for the vertical transmission of Buchnera from mother to offspring, ensuring continuation of the symbiotic relationship.

The study of cls and cardiolipin biosynthesis in Buchnera therefore offers insights into the molecular underpinnings of this ancient and obligate symbiosis.

How can genomic context analysis enhance our understanding of cls function in Buchnera aphidicola?

Genomic context analysis provides valuable insights into cls function within the highly reduced Buchnera genome. Unlike free-living bacteria where gene arrangement can be fluid, endosymbionts often show distinctive patterns of gene organization reflective of their evolutionary history and metabolic constraints:

Similar approaches have been used successfully in studying other Buchnera genes, such as the trpDC(F)BA operon involved in tryptophan biosynthesis, which revealed insights into how Buchnera contributes essential amino acids to its aphid host .

How has the cls gene evolved in Buchnera compared to other endosymbionts?

The evolution of cls in Buchnera aphidicola provides a fascinating case study in endosymbiont genome evolution. Comparative analysis reveals several key insights:

  • Conservation despite genome reduction: While Buchnera aphidicola has undergone extreme genome reduction (typical genome size ~640 kb), the maintenance of cls suggests its essential function. This contrasts with many other metabolic genes that have been lost during reductive evolution.

  • Evolutionary rate: Like other Buchnera genes, cls likely shows an accelerated evolutionary rate compared to free-living relatives, due to factors including relaxed selection pressure, genetic drift due to population bottlenecks during transmission, and adaptation to the intracellular environment.

  • Endosymbiont comparison: When compared to other insect endosymbionts (like Blochmannia in ants or Wigglesworthia in tsetse flies), patterns of cls conservation can reveal convergent or divergent evolutionary trajectories based on host biology and metabolic integration.

  • Selection signatures: Analysis of nonsynonymous to synonymous substitution ratios (dN/dS) in cls sequences across Buchnera strains can reveal whether the gene is under purifying selection (maintaining function) or positive selection (adapting to new conditions).

The study of cls evolution provides insights into the molecular basis of the 200-250 million-year-old symbiotic relationship between Buchnera and aphids , highlighting how essential cellular functions are maintained even as genomes undergo dramatic reduction.

What techniques can be used to study the impact of cls mutations on Buchnera-aphid symbiosis?

  • Comparative genomics and natural variation:

    • Sequencing cls genes from various Buchnera strains across aphid species

    • Correlating sequence variations with differences in symbiotic phenotypes

    • Using population genetics approaches to identify selection signatures

  • Heterologous expression systems:

    • Expressing wild-type and mutant Buchnera cls in E. coli cls knockout strains

    • Assessing complementation ability and phenotypic effects

    • Measuring enzymatic activity of purified wild-type and mutant proteins

  • Modern symbiosis manipulation approaches:

    • Using antibiotic treatments to reduce or eliminate Buchnera in aphids

    • Microinjection of synthesized or modified Buchnera cells

    • RNA interference targeting host factors that interact with bacterial membranes

  • Advanced imaging techniques:

    • Fluorescent lipid probes to visualize cardiolipin distribution in bacteriocytes

    • Correlative light and electron microscopy to examine membrane structures

    • Live-cell imaging to track Buchnera division and transmission

  • Systems biology approaches:

    • Metabolomic analysis of phospholipid composition in Buchnera membranes

    • Transcriptomic studies to identify compensatory responses to membrane alterations

    • Mathematical modeling of lipid metabolism in the Buchnera-aphid system

These complementary approaches circumvent the limitations of working with an unculturable endosymbiont while providing meaningful data on cls function in the symbiotic context.

How does the expression and regulation of cls in Buchnera compare with that in free-living bacteria?

The expression and regulation of cls in Buchnera aphidicola likely differs significantly from free-living bacteria, reflecting its adaptation to the endosymbiotic lifestyle:

  • Regulatory simplification: Genomic studies of Buchnera genes have revealed a pattern of regulatory simplification. For example, the CysE enzyme in Buchnera lacks feedback inhibition present in E. coli, potentially leading to constitutive activity . Similar simplifications may exist for cls regulation.

  • Transcriptional control: Buchnera has lost many transcription factors present in free-living relatives, suggesting a more constitutive expression pattern for many genes. Analysis of the promoter region of cls could reveal whether sophisticated regulation has been maintained or simplified.

  • Environmental responsiveness: Free-living bacteria often modulate cardiolipin content in response to environmental stressors or growth phases. The stable environment within aphid bacteriocytes may have reduced the need for such responsive regulation in Buchnera.

  • Host factors: Unlike free-living bacteria, Buchnera gene expression may be influenced by host-derived factors that penetrate the bacterial membrane or affect the bacteriocyte environment.

  • Metabolic integration: Expression of cls in Buchnera may be coordinated with host lipid metabolism, creating an integrated system rather than the autonomous regulation seen in free-living bacteria.

These differences illustrate how endosymbiosis has fundamentally altered gene regulation in Buchnera, with cls serving as an important example of how core bacterial functions adapt to the symbiotic lifestyle.

How can recombinant Buchnera cls be utilized in synthetic biology applications?

Recombinant Buchnera aphidicola cls offers several promising applications in synthetic biology:

  • Membrane engineering: Cardiolipin has unique properties that affect membrane curvature and protein interactions. Recombinant cls could be used to modulate cardiolipin content in synthetic membrane systems or engineered microorganisms for specific applications.

  • Minimal genome projects: As a conserved gene in a highly reduced genome, cls represents an essential function that would likely be included in minimal genome constructs. Understanding its specific requirements and interactions contributes to minimal cell design efforts.

  • Synthetic symbiosis: Insights from Buchnera cls could inform efforts to engineer new symbiotic relationships between microbes and eukaryotic hosts, particularly in designing membrane properties that facilitate metabolic exchange while preventing host defense activation.

  • Novel bioreactors: Engineered microorganisms with optimized membrane properties derived from Buchnera cls studies could lead to more efficient bioreactors, particularly for processes involving membrane-associated reactions or nutrient exchange.

  • Protein evolution studies: The natural adaptation of cls to the endosymbiotic lifestyle provides a model for directed evolution experiments aiming to adapt enzymes to new cellular environments or functions.

These applications highlight how fundamental research on Buchnera endosymbionts can translate into practical biotechnological innovations.

What methodological approaches can overcome the challenges of studying unculturable endosymbionts?

Studying unculturable endosymbionts like Buchnera aphidicola requires innovative methodological approaches:

ApproachMethodologyApplications for cls ResearchLimitations
Genomics and Transcriptomics- Whole genome sequencing
- RNA-Seq
- Single-cell genomics
- cls sequence analysis
- Expression patterns
- Regulatory elements
- Limited functional validation
- RNA isolation challenges
Heterologous Systems- Expression in E. coli
- Yeast complementation
- Cell-free systems
- Protein production
- Mutational analysis
- Biochemical characterization
- Different cellular context
- Potential folding issues
Imaging Technologies- TEM with immunogold labeling
- Super-resolution microscopy
- FISH for localization
- Subcellular localization
- Membrane distribution
- Interaction with host structures
- Fixation artifacts
- Limited in vivo application
Host Manipulation- Antibiotic clearance
- Artificial diet studies
- Microinjection
- Phenotypic effects of symbiont alteration
- Metabolic dependencies
- Host survival issues
- Experimental variability
Computational Approaches- Metabolic modeling
- Protein structure prediction
- System-level simulations
- Function prediction
- Interaction networks
- Evolutionary analysis
- Validation requirements
- Model limitations

By combining these complementary approaches, researchers can overcome the inherent limitations of working with unculturable endosymbionts and develop a comprehensive understanding of cls function in Buchnera aphidicola.

What emerging technologies could advance our understanding of cardiolipin synthase function in host-symbiont interactions?

Several cutting-edge technologies show promise for advancing our understanding of cardiolipin synthase in the Buchnera-aphid symbiosis:

  • CRISPR-based approaches:

    • Development of CRISPR interference systems deliverable to endosymbionts

    • Host genome editing to modify bacteriocyte properties

    • CRISPR-based imaging to visualize cls localization in live bacteriocytes

  • Advanced lipidomics:

    • High-resolution mass spectrometry to characterize cardiolipin molecular species

    • Stable isotope labeling to track lipid flux between host and symbiont

    • Single-cell lipidomics to analyze individual bacteriocytes

  • Synthetic biology tools:

    • Engineered minimal Buchnera-like cells with controllable cls expression

    • Synthetic bacteriocytes to study membrane-host interactions

    • Cell-free expression systems optimized for membrane protein synthesis

  • Structural biology advances:

    • Cryo-electron microscopy of Buchnera membranes

    • Integrative structural modeling of cls in native membrane environment

    • Time-resolved structural studies to capture catalytic intermediates

  • Multi-omics integration:

    • Combined genomic, transcriptomic, proteomic, and metabolomic analyses

    • Machine learning approaches to identify patterns across multi-omics datasets

    • Systems-level modeling of lipid metabolism in the symbiotic system

These emerging technologies, especially when used in combination, have the potential to overcome current limitations in studying this fascinating obligate endosymbiont and its essential membrane biosynthesis pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.