Recombinant Buchnera aphidicola subsp. Schizaphis graminum Cytochrome o ubiquinol oxidase protein CyoD (cyoD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Buchnera aphidicola subsp. Schizaphis graminum Cytochrome o Ubiquinol Oxidase Protein CyoD (cyoD)

CyoD is a subunit of the cytochrome o ubiquinol oxidase complex (cytochrome bo₃), a terminal oxidase in bacterial respiratory chains. In Buchnera aphidicola subsp. Schizaphis graminum (a primary endosymbiont of the aphid Schizaphis graminum), this protein plays a critical role in electron transport and ATP synthesis. The recombinant form is produced via heterologous expression in E. coli, enabling structural and functional studies of this membrane-bound protein .

Expression and Yield

ParameterDetails
Expression HostE. coli
TagVariable (dependent on production process)
Purity>90% (SDS-PAGE confirmed)
StorageLyophilized powder; store at -20°C/-80°C

Protocol Highlights:

  • Expression: Induced in E. coli under optimized conditions for toxic proteins .

  • Purification: Affinity chromatography (via His-tag) followed by buffer exchange (Tris/PBS-based buffer with 6% trehalose) .

  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term stability .

Gene Expression Dynamics

In E. coli knockout strains designed to mitigate cellular stress responses (CSR), cyoD exhibited 1.45-fold up-regulation compared to wild-type controls. This contrasts with other cytochrome bo₃ subunits (cyoA–cyoE), which were down-regulated under CSR .

StraincyoD ExpressionCSR Impact
Wild-Type E. coliBasal levelsSevere CSR triggers down-regulation
ΔelaAΔcysW (DKO)↑1.45-foldPartially mitigated CSR effects

Implications:

  • Regulatory Role: CyoD may compensate for reduced activity of other cytochrome subunits under stress .

  • Symbiotic Relevance: In Buchnera, cytochrome bo₃ is critical for ATP production, supporting the aphid’s nutrient-deficient diet .

Experimental Uses

ApplicationMethodology
ELISA AssaysRecombinant CyoD as antigen for detecting host-antibody interactions
Protein-Protein InteractionsCo-immunoprecipitation (e.g., with cytochrome oxidase subunits)
Structural StudiesX-ray crystallography or cryo-EM to resolve membrane topology

Notable Observations:

  • Interaction Specificity: CyoD’s role in stabilizing the cytochrome bo₃ complex remains poorly characterized, necessitating further structural studies .

Genomic Retention in Buchnera

FactorObservation
Gene OrderConserved in Buchnera genomes despite AT-rich sequence divergence
Codon UsageOptimized for translation efficiency in highly expressed genes
Symbiotic DependencyEssential for ATP synthesis, compensating for aphid’s dietary limitations

Key Insights:

  • Co-evolution: Buchnera’s cytochrome bo₃ genes reflect parallel evolution with aphid hosts, driven by mutual metabolic needs .

  • Reduction in Genome Size: Retention of cyoD highlights selective pressure to maintain core metabolic functions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cyoD; BUsg_453; Cytochrome bo(3 ubiquinol oxidase subunit 4; Cytochrome o ubiquinol oxidase subunit 4; Cytochrome o subunit 4; Oxidase bo(3 subunit 4; Ubiquinol oxidase polypeptide IV; Ubiquinol oxidase subunit 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
cyoD
Target Protein Sequence
MNKYKKIKNNFDKEKKSYIVGFLFSLFLTIIPFFCTLNHLFSRKINFFVILLCALSQIII HFIYFLHLDFSKKNSWNIISLLFILIIVFIIVFGSIWIMYNLNHHVIL
Uniprot No.

Target Background

Function

Cytochrome bo(3) ubiquinol terminal oxidase is a key component of the aerobic respiratory chain in E. coli, predominantly expressed under high aeration conditions. Besides electron transfer, it exhibits proton pump activity across the membrane, transporting 2 protons per electron.

Database Links
Protein Families
Cytochrome c oxidase bacterial subunit 4 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and what is its relationship with Schizaphis graminum?

Buchnera aphidicola is an obligate endosymbiotic bacterium that lives within specialized cells (bacteriocytes) of aphids, including Schizaphis graminum (commonly known as greenbug aphid). This bacterium has a mutualistic relationship with its aphid host, providing essential nutrients that are absent from the aphid's diet of phloem sap. Schizaphis graminum is a serious aphid pest on small grains in North America that feeds by inserting its stylet into phloem sieve elements and consuming phloem sap . The aphid initially causes red or necrotic spots on crops such as sorghum (Sorghum bicolor) and wheat (Triticum aestivum), ultimately leading to general necrosis and plant death .

The symbiotic relationship between Buchnera and aphids is characterized by coevolution and metabolic complementarity. Through millions of years of coevolution, Buchnera has undergone significant genome reduction, retaining primarily genes essential for its symbiotic role.

What is the cytochrome o ubiquinol oxidase system and what is the role of CyoD?

Cytochrome o ubiquinol oxidase is a terminal oxidase in the aerobic respiratory chain of many bacteria, including Buchnera aphidicola. This enzyme complex catalyzes the final step in the electron transport chain, where electrons from ubiquinol are transferred to molecular oxygen, reducing it to water while simultaneously pumping protons across the membrane to generate a proton motive force used for ATP synthesis.

The enzyme typically consists of multiple subunits, with CyoD being one of the smaller membrane-embedded subunits. While the specific function of CyoD in Buchnera aphidicola has not been extensively characterized, in related bacteria, CyoD plays crucial roles in:

  • Complex assembly and stability

  • Facilitating proper folding and insertion of other subunits

  • Potentially contributing to proton translocation pathways

  • Maintaining the structural integrity of the enzyme complex

The retention of the cyoD gene in the highly reduced genome of Buchnera aphidicola suggests that this protein plays an essential role in the bacterium's metabolism and survival within the aphid host.

Why is the genome of Buchnera aphidicola important for understanding endosymbiont evolution?

Buchnera aphidicola genomes provide exceptional models for studying genomic reduction in obligate endosymbionts. The genome of B. aphidicola from Schizaphis graminum (BSg) exhibits characteristic features of long-term endosymbiosis, including:

Genomic propertyValue for B. aphidicola BSg
Genome size (bp)653,001
Chromosome size (bp)642,454
Plasmid size (bp)11,547
Total number of genes597
Number of CDS (chromosome + plasmids)550 + 9
Number of rRNA genes3
Number of tRNA genes32
Number of other RNA genes3
Number of pseudogenes33
Average length of CDS (bp)979
Average length of IGR (bp)113.30
G+C content (%)26.30

These genomic characteristics reveal evolutionary patterns related to obligate endosymbiosis . Studying the retention of specific genes like cyoD provides insights into which metabolic functions are essential for the symbiotic relationship.

How do aphid-Buchnera interactions influence gene expression in both organisms?

The intimate association between aphids and Buchnera aphidicola creates a complex system of reciprocal genetic and metabolic influences:

  • Nutritional Exchange: The aphid provides nutrients and a stable environment, while Buchnera synthesizes essential amino acids and other compounds missing from the aphid's phloem-based diet.

  • Coordinated Gene Expression: Research suggests that gene expression in both partners can be synchronized in response to environmental changes, developmental stages, and nutritional status.

  • Metabolic Integration: The metabolic pathways of host and symbiont have become integrated over evolutionary time, with complementary gene loss and retention patterns.

  • Stress Responses: When aphids encounter stressors such as plant defense compounds activated during feeding, both aphid and bacterial gene expression can be affected. For example, when aphids like Schizaphis graminum feed on sorghum, the plant activates jasmonic acid and salicylic acid-regulated defense genes . These plant responses can indirectly impact Buchnera within the aphid.

Understanding these interactions provides important context for studying any specific protein, including Cytochrome o ubiquinol oxidase protein CyoD.

What metabolic capabilities has Buchnera aphidicola retained or lost through evolution?

Buchnera aphidicola has undergone massive gene loss during its evolutionary history as an endosymbiont, particularly affecting metabolic pathways. Despite this reduction, it has selectively retained genes essential for its symbiotic role.

Key metabolic insights from comparative genomics include:

  • Retained Pathways: Buchnera typically retains pathways for synthesizing essential amino acids and vitamins that the aphid cannot obtain from its phloem diet.

  • Lost Pathways: Many biosynthetic pathways for non-essential amino acids, lipids, cell envelope components, and regulatory elements have been lost.

  • Metabolic Complementation: In some cases, metabolic functions lost in Buchnera may be compensated by the aphid host or secondary endosymbionts. For example, in certain aphid lineages, "Candidatus Serratia symbiotica" may complement inadequate nutrient provisioning by Buchnera .

  • Strain-Specific Variations: Different Buchnera strains show variations in metabolic capabilities. For instance, B. aphidicola from Cinara tujafilina retains the ability to synthesize tryptophan independently, while B. aphidicola from Cinara cedri requires metabolic complementation with "Candidatus Serratia symbiotica" .

The retention of respiratory genes like cyoD in the highly reduced genome suggests they play essential roles that could not be lost or replaced during evolution.

What are the challenges in expressing recombinant proteins from obligate endosymbionts like Buchnera aphidicola?

Expressing recombinant proteins from Buchnera aphidicola presents several significant challenges:

  • Unculturable Nature: As an obligate endosymbiont, Buchnera cannot be cultured outside its host, necessitating genetic approaches for protein production.

  • Atypical Genetic Features:

    • Highly biased codon usage reflecting the AT-rich genome (G+C content of only 26.30% in BSg)

    • Potentially altered gene regulatory elements

    • Modified ribosome binding sites that may not function efficiently in conventional expression systems

  • Membrane Protein Challenges: The CyoD protein, as part of the membrane-bound cytochrome o ubiquinol oxidase complex, presents additional challenges:

    • Hydrophobic domains requiring special solubilization strategies

    • Proper membrane insertion and folding requirements

    • Potential toxicity to heterologous hosts when overexpressed

    • Requirements for specific lipid environments

  • Protein Folding Concerns: The specialized intracellular environment of bacteriocytes may provide unique conditions for protein folding that are difficult to replicate in heterologous systems.

  • Potential Requirement for Partner Proteins: CyoD typically functions as part of a multi-subunit complex, and isolated expression may yield improperly folded or non-functional protein.

These challenges necessitate careful optimization of expression systems and conditions to obtain functional recombinant protein.

What methodologies can be employed to purify and characterize recombinant CyoD protein?

A comprehensive approach to purifying and characterizing recombinant CyoD would include:

  • Expression System Selection:

    • E. coli-based systems with codon optimization

    • Cell-free expression systems that bypass cellular toxicity issues

    • Baculovirus-insect cell systems for membrane proteins

    • Specialized strains with chaperones for difficult-to-fold proteins

  • Purification Strategy:

    • Affinity chromatography using epitope tags (His-tag, FLAG-tag)

    • Membrane protein extraction using appropriate detergents (DDM, LDAO, etc.)

    • Nanodisc or liposome reconstitution for functional studies

    • Size exclusion chromatography for final purification and buffer exchange

  • Structural Characterization:

    • Circular dichroism spectroscopy for secondary structure assessment

    • Cryo-electron microscopy for membrane protein structure determination

    • X-ray crystallography (challenging for membrane proteins)

    • Hydrogen-deuterium exchange mass spectrometry for dynamics assessment

  • Functional Characterization:

    • Oxygen consumption assays to measure enzymatic activity

    • Proton pumping assays using pH-sensitive fluorescent dyes

    • Reconstitution into liposomes for transport studies

    • Spectroscopic analysis of heme binding and redox properties

  • Interaction Studies:

    • Pull-down assays to identify protein-protein interactions

    • Surface plasmon resonance for binding kinetics

    • Crosslinking mass spectrometry for interaction interfaces

    • Isothermal titration calorimetry for thermodynamic parameters

Each step requires careful optimization, particularly considering the unique challenges posed by proteins from obligate endosymbionts.

How can comparative genomics inform understanding of cyoD evolution in Buchnera aphidicola?

Comparative genomics offers powerful approaches for understanding the evolution of cyoD in Buchnera aphidicola:

  • Sequence Conservation Analysis:

    • Comparison of cyoD sequences across different Buchnera strains reveals selective pressures

    • Identification of conserved residues essential for function

    • Detection of lineage-specific adaptations through non-synonymous substitution rates

  • Genomic Context Analysis:

    • Examination of operon structure and gene synteny across Buchnera strains

    • Identification of regulatory elements that have been maintained or lost

    • Comparison with free-living relatives to identify endosymbiosis-specific changes

  • Phylogenetic Reconstruction:

    • Construction of gene trees to track the evolutionary history of cyoD

    • Comparison with species trees to identify potential horizontal gene transfer events

    • Analysis of the last common symbiotic ancestor (LCSA) gene content

  • Selection Pressure Analysis:

    • Calculation of dN/dS ratios to determine if purifying, neutral, or positive selection is acting on cyoD

    • Identification of specific amino acid sites under selection

    • Correlation of selection patterns with known functional domains

  • Metabolic Network Analysis:

    • Placement of CyoD within the context of the reduced metabolic network

    • Identification of connected pathways that have been retained or lost

    • Assessment of the essentiality of cytochrome o ubiquinol oxidase within the reduced metabolic network

These approaches can reveal why cyoD has been retained despite extensive genome reduction and how its sequence and function may have adapted to the endosymbiotic lifestyle.

What experimental approaches can be used to study CyoD function in an unculturable bacterium?

Studying proteins from unculturable bacteria requires creative experimental approaches:

These approaches can be combined to build a comprehensive understanding of CyoD function despite the inability to culture Buchnera aphidicola in isolation.

How does genome reduction affect respiratory chain function in Buchnera aphidicola?

Genome reduction in Buchnera aphidicola has profound implications for respiratory metabolism:

  • Streamlined Electron Transport Chain:

    • Many components of the respiratory chain present in free-living relatives have been lost

    • Retention of cytochrome o ubiquinol oxidase suggests its essential nature

    • Simplified regulatory networks controlling respiratory gene expression

  • Metabolic Integration with Host:

    • The respiratory chain must function within the metabolic context provided by the aphid host

    • Potential dependence on host-derived metabolites as electron donors

    • Adaptation to the oxygen availability within bacteriocytes

  • Energy Production Balance:

    • Respiratory chain may be optimized for the reduced energy demands of the endosymbiont

    • Shift in the balance between energy production and biosynthetic functions

    • Potential specialization for specific host-beneficial functions

  • Functional Constraints:

    • Evidence suggests that metabolism serves as a functional constraint in genome reduction

    • Respiratory functions may be maintained due to their essential role in energy production

    • Possible dual roles of respiratory components in both energy production and redox balance

  • Evolutionary Trade-offs:

    • Loss of alternative respiratory pathways may reduce metabolic flexibility

    • Specialized adaptation to the stable environment within the host

    • Potential vulnerability to oxidative stress due to loss of protective mechanisms

Understanding these adaptations provides insights into how essential cellular functions are maintained despite extensive gene loss.

What is the significance of retaining respiratory genes in light of metabolic complementation in aphid-Buchnera symbiosis?

The retention of respiratory genes like cyoD in Buchnera aphidicola is particularly interesting in the context of metabolic complementation:

  • Core vs. Complementable Functions:

    • Respiratory functions appear to be retained as core Buchnera functions rather than being subject to complementation

    • This contrasts with certain biosynthetic pathways that can be complemented by secondary symbionts

  • Secondary Symbionts:

    • In some aphid lineages, "Candidatus Serratia symbiotica" complements Buchnera for inadequate nutrient provisioning

    • Different Serratia strains show varying degrees of integration, from facultative to obligate associations

    • The presence of secondary symbionts appears to allow further metabolic streamlining in Buchnera

  • Metabolic Specialization:

    • The retention of respiratory genes in Buchnera suggests they cannot be easily complemented

    • This indicates a metabolic specialization where energy production remains a core Buchnera function

    • Biosynthetic pathways, by contrast, may be more amenable to complementation

  • Evolutionary Implications:

    • The pattern of gene retention provides insights into the constraints on endosymbiont evolution

    • Essential genes that cannot be complemented form an irreducible core genome

    • The presence of secondary symbionts may accelerate genome reduction in specific metabolic areas

  • Respiratory Chain as an Integration Point:

    • The respiratory chain may serve as a critical integration point between different cellular processes

    • Its central role in energy production, redox balance, and membrane potential maintenance may make it difficult to complement

How might the study of CyoD contribute to understanding aphid-plant interactions?

Investigating CyoD and respiratory metabolism in Buchnera aphidicola may provide unexpected insights into aphid-plant interactions:

  • Energetic Support for Aphid Feeding:

    • Efficient respiratory metabolism in Buchnera may support aphid fitness during plant colonization

    • Energy production in the endosymbiont could indirectly influence the aphid's ability to overcome plant defenses

  • Response to Plant Defense Compounds:

    • When aphids like Schizaphis graminum feed on plants such as sorghum, they trigger plant defenses including jasmonic acid and salicylic acid-regulated genes

    • These plant responses may indirectly affect Buchnera metabolism

    • Respiratory proteins like CyoD might play a role in detoxification or stress response

  • Adaptation to Host Plant Chemistry:

    • Different aphid species feed on different host plants with varying phloem composition

    • Buchnera metabolism, including respiratory functions, may show adaptations reflecting the host plant chemistry

    • Comparative analysis of CyoD across Buchnera from aphids with different host preferences could reveal such adaptations

  • Metabolic Integration in Agricultural Contexts:

    • Understanding the metabolic dependencies of aphid pests could inform novel control strategies

    • Targeting symbiont-specific respiratory functions could potentially disrupt the symbiosis

    • This approach might complement traditional resistance mechanisms in crops like sorghum

  • Evolutionary Aspects of Tritrophic Interactions:

    • The plant-aphid-Buchnera system represents a complex tritrophic interaction

    • Respiratory metabolism in Buchnera may have coevolved in response to plant chemistry and aphid adaptation

    • Studying this system could reveal evolutionary patterns in multi-level symbiotic interactions

This research direction connects molecular-level studies of symbiont proteins with broader ecological and agricultural questions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.