Recombinant Buchnera aphidicola subsp. Schizaphis graminum Cytochrome o ubiquinol oxidase subunit 3 (cyoC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
cyoC; BUsg_454; Cytochrome bo(3 ubiquinol oxidase subunit 3; Cytochrome o ubiquinol oxidase subunit 3; Cytochrome o subunit 3; Oxidase bo(3 subunit 3; Ubiquinol oxidase polypeptide III; Ubiquinol oxidase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
cyoC
Target Protein Sequence
MIKETMRNNKLFGLWIYLMSDCIIFAVLFAVYAIISSNFSTNLINHKIFNLSYVFLETLI LLLSSLSSGMLTIQKNKNNIKIIYFYLLLTFFLGLSFLLMEVNEFYKLILENCSPSQHAF FSIFFTIVGVHGIHVFFGLIFILSILYQLFYLGITNTIRIRILCFSLFWHFLDIIWICVF TFVYLNGVI
Uniprot No.

Target Background

Function
Cytochrome bo(3) ubiquinol terminal oxidase is a component of the aerobic respiratory chain in *E. coli* that predominates when cells are grown under high aeration conditions. It exhibits both proton pump activity across the membrane and electron transfer, pumping 2 protons per electron.
Database Links
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of Buchnera aphidicola in aphid biology?

Buchnera aphidicola represents a classic model of obligate endosymbiosis, having evolved from a free-living bacterium to an intracellular symbiont of aphids approximately 200 million years ago. Genomic analysis reveals that this transition coincided with extensive genome reduction and the establishment of remarkable genomic stasis, as evidenced by nearly perfect gene-order conservation across different Buchnera strains . The symbiosis enables aphids to exploit nutrient-poor diets and has significantly influenced the diversification of aphid species. This evolutionary relationship provides an exceptional system for studying reductive genome evolution, host-symbiont coevolution, and metabolic interdependence in endosymbiotic relationships .

How does the structure of cytochrome o ubiquinol oxidase differ from cytochrome c oxidase?

Cytochrome o ubiquinol oxidase belongs to the haem-copper cytochrome oxidase superfamily, which functions as terminal catalysts in respiratory chains of aerobic organisms. While sharing structural similarities with cytochrome c oxidase, particularly in the functional core surrounding metal-binding sites in subunit I, there are subtle but important differences due to distinct subunit composition . The primary functional difference lies in substrate binding: cytochrome c oxidase binds cytochrome c at its periplasmic surface (partially via subunit II), whereas ubiquinol oxidases must accommodate hydrophobic substrates within the membrane bilayer. Studies using photoreactive radiolabelled substrate analogues indicate that subunit II is at least partially involved in ubiquinol binding, though the precise binding site configuration differs significantly from that of cytochrome c oxidase .

What techniques are commonly used to isolate and quantify Buchnera from aphid hosts?

The isolation and quantification of Buchnera from aphid hosts typically involves several specialized techniques:

  • Bacteriocyte characterization: Bacteriocytes (specialized aphid cells housing Buchnera) can be identified and isolated using microscopy techniques. PCR confirmation with Buchnera-specific primers targeting genes such as 16S rRNA or dnaK verifies the presence of the symbiont .

  • DNA extraction protocol:

    • Place individual aphids in lysis buffer (100 mM Tris-HCl, 10 mM Na₂EDTA, 1% SDS, pH 8.0)

    • Freeze at -20°C for 4 minutes before maceration

    • Incubate homogenate at 65°C for 45 minutes

    • Add 120 μl 3M sodium acetate (CH₃COONa) and keep on ice for 1 hour

    • Centrifuge at 12,000 rpm at 4°C for 10 minutes

    • Transfer supernatant and extract twice using equal volumes of phenol-chloroform-isoamyl alcohol (25:24:1, pH 8.0)

  • Quantification methods: Buchnera density can be assessed either by counting bacteriocytes via microscopy or through quantitative PCR targeting Buchnera-specific genes, with normalization against aphid host genes (such as ef1α) .

What are the optimal expression systems for producing recombinant Buchnera aphidicola cytochrome o ubiquinol oxidase subunit 3?

The expression of recombinant Buchnera aphidicola proteins presents unique challenges due to the organism's reduced genome and specialized metabolic requirements. When expressing recombinant cyoC, researchers must consider several factors:

  • Expression host selection: E. coli-based expression systems are most commonly employed due to phylogenetic relatedness to Buchnera and established protocols for membrane protein expression. BL21(DE3) and C41(DE3) strains are particularly suited for membrane proteins like cyoC.

  • Codon optimization: Buchnera's AT-rich genome and restricted tRNA repertoire necessitate codon optimization when expressing in heterologous systems to avoid translational stalling and truncated products.

  • Membrane protein solubilization: The hydrophobic nature of cyoC requires specialized extraction and purification approaches:

    • Use of mild detergents (DDM, LDAO)

    • Membrane scaffold proteins for nanodisc formation

    • Amphipol stabilization for structural studies

  • Functional assessment: Ensuring proper folding and function through activity assays measuring ubiquinol oxidation rates and proton pumping capacity.

The selection of appropriate vectors incorporating solubility tags (MBP, SUMO) often improves yields of functional protein compared to conventional His-tag approaches alone .

How do host plant species influence Buchnera aphidicola population dynamics and cyoC expression levels?

Host plant species significantly impacts Buchnera aphidicola population dynamics within aphids through several mechanisms:

  • Nutritional quality variation: Different host plants provide varying profiles of essential amino acids, carbohydrates, and micronutrients that directly influence Buchnera metabolism and replication rates.

  • Aphid sampling methodology: Research protocols typically involve collecting single aphids from individual plants to capture maximum genetic diversity (n=22-24 per plant species), with subsequent rearing on original host plant leaves in controlled conditions (24°C, fresh leaves every 3-4 days) .

  • Quantification approach: Buchnera density assessment involves:

    • Preservation of 5-day-old first-generation aphids

    • Bacteriocyte characterization through PCR confirmation using Buchnera-specific primers

    • Comparison across different plant hosts (cotton, cucumber, pumpkin, zucchini, hibiscus)

Host PlantAverage Bacteriocyte CountRelative cyoC ExpressionSample Size
CottonHigherVariablen=24
CucumberIntermediateVariablen=24
PumpkinIntermediateVariablen=24
ZucchiniLowerBaselinen=24

These plant-mediated effects on Buchnera populations subsequently influence the expression levels of metabolic genes, including those in the cytochrome o ubiquinol oxidase complex, though specific regulation mechanisms for cyoC remain under investigation .

What structural analysis techniques have proven most effective for characterizing cytochrome o ubiquinol oxidase complexes?

The structural characterization of cytochrome o ubiquinol oxidase complexes has been most effectively accomplished through complementary approaches:

  • Cryo-electron microscopy: Two-dimensional crystals of cytochrome bo have been analyzed by cryo-EM, producing diffraction beyond 5 Å resolution. This technique has enabled the calculation of projection maps at 6 Å resolution, allowing identification of all four subunits and resolution of individual α-helices within the protein complex .

  • Comparative structural analysis: Comparing the structure with cytochrome c oxidase reveals both the structural similarity within the common functional core (particularly surrounding metal-binding sites in subunit I) and subtle differences stemming from distinct subunit compositions .

  • Substrate binding site identification: Photoreactive radiolabelled substrate analogues have been employed to localize the ubiquinol binding site, with evidence indicating partial involvement of subunit II, differing from the periplasmic binding site of cytochrome c in cytochrome c oxidases .

  • Gold-labeling techniques: For precise localization of substrate binding sites and subunit positioning, gold-labeled ubiquinol derivatives have been employed in electron crystallography studies, similar to approaches used successfully with cytochrome c oxidase .

Future structural characterization is expected to advance through tilt series recording to obtain three-dimensional data of the cytochrome bo complex, facilitating more accurate comparisons with available X-ray crystallographic data from cytochrome c oxidases .

What are the critical parameters for successful PCR amplification of Buchnera aphidicola genes from aphid samples?

Successful PCR amplification of Buchnera aphidicola genes from aphid samples requires careful optimization of several parameters:

  • DNA extraction quality: Follow specialized protocols for aphid DNA extraction that effectively separate Buchnera DNA from host material:

    • Fresh or properly preserved samples (-20°C in 75% ethanol)

    • Complete homogenization in appropriate lysis buffer

    • Thorough phenol-chloroform purification steps

  • Primer design considerations:

    • Specificity for Buchnera-specific sequences (e.g., dnaK, 16S rRNA)

    • Avoidance of regions with polymorphisms among Buchnera strains

    • Optimized GC content and annealing temperatures

    • Inclusion of appropriate controls (e.g., aphid ef1α gene as negative control)

  • Optimized PCR protocol:

    • Initial denaturation: 95°C for 10 minutes

    • 6 cycles of: 95°C for 30s, 60°C for 30s (decreasing by 1°C each cycle), 72°C for 30s

    • 30 cycles of: 95°C for 30s, 55°C for 1 min, 72°C for 30s

    • Final elongation: 72°C for 10 minutes

  • Verification methods:

    • Gel electrophoresis with appropriate molecular weight markers

    • Sequencing of amplicons to confirm specificity

    • Quantitative PCR for abundance assessment

Following these parameters ensures reliable amplification of Buchnera genes, though intrapopulational variation (approximately 1,200 polymorphic sites observed in some strains) may require consideration when designing primers for specific Buchnera strains .

How can researchers distinguish between host and symbiont gene expression when studying Buchnera-aphid systems?

Distinguishing between host and symbiont gene expression in Buchnera-aphid systems requires sophisticated methodological approaches:

  • RNA extraction and quality control:

    • Use of specialized extraction kits (e.g., Qiagen RNeasy Mini Kit)

    • DNase treatment to eliminate DNA contamination

    • RNA integrity assessment via bioanalyzer

    • cDNA synthesis using advanced protocols (e.g., BioRad iScript Advanced cDNA Synthesis Kit)

  • Transcriptome assembly and contamination removal:

    • High-throughput sequencing (Illumina paired-end) generating millions of raw reads

    • Assembly using tools like Trinity

    • Critical filtering step to remove contaminating sequences:

      • Elimination of wheat (host plant) contigs

      • Removal of microbial contigs unrelated to Buchnera

      • Alignment to reference genomes when available

  • Differential analysis approaches:

    • Use of software like DESeq2 after contamination removal

    • Principal component analysis to separate sources of variation

    • Likelihood ratio tests to assess relative importance of experimental factors

    • Comparison with annotated reference genomes

  • Verification through targeted approaches:

    • Real-time PCR with carefully selected standards

    • RNAi experiments for functional validation

    • Tissue-specific expression analysis to determine distribution within aphid body

This multifaceted approach enables researchers to disentangle the complex gene expression dynamics in this symbiotic relationship, particularly important when studying differential responses to environmental conditions or experimental treatments.

What protein folding challenges are specific to Buchnera aphidicola proteins, and how can they be addressed in recombinant expression systems?

Buchnera aphidicola proteins present unique folding challenges that require specific strategies in recombinant expression systems:

  • Inherent folding inefficiency: Computational studies predict that Buchnera proteins, like those of other intracellular bacteria, have generally lower folding efficiency compared to proteins from free-living bacteria. This evolutionary consequence of genome reduction necessitates specialized approaches for recombinant expression .

  • Membrane protein challenges: For membrane proteins like cytochrome o ubiquinol oxidase subunit 3 (cyoC), additional complexities include:

    • Hydrophobic domains requiring specialized solubilization

    • Proper insertion into lipid environments

    • Assembly with other subunits of the complex

    • Correct orientation and topology

  • Optimization strategies:

    • Temperature reduction during expression (16-18°C)

    • Co-expression with chaperones from the host organism

    • Use of specialized E. coli strains designed for toxic or difficult-to-express proteins

    • Fusion with solubility-enhancing tags that can be later removed

    • Addition of stabilizing ligands during purification

  • Quality assessment:

    • Circular dichroism to assess secondary structure

    • Size-exclusion chromatography to evaluate aggregation state

    • Activity assays to confirm functional folding

    • Limited proteolysis to identify properly folded domains

These challenges reflect the degenerative genomic features observed in Buchnera, which has lost many genes involved in protein folding and quality control during its evolution as an obligate endosymbiont .

How can structural insights from cytochrome o ubiquinol oxidase inform the development of aphid-specific control strategies?

Structural insights from cytochrome o ubiquinol oxidase provide several avenues for developing aphid-specific control strategies:

  • Targeted disruption of symbiosis: The cytochrome o ubiquinol oxidase complex is essential for Buchnera's respiratory function. Detailed structural understanding enables the design of compounds that specifically inhibit this complex in Buchnera without affecting similar complexes in other organisms:

    • Identification of binding pocket differences between Buchnera and other bacterial oxidases

    • Exploitation of unique residues in the ubiquinol binding site

    • Development of structure-based inhibitors that target Buchnera-specific features

  • Functional dependency analysis: Understanding the precise role of cytochrome o ubiquinol oxidase in maintaining the aphid-Buchnera symbiosis:

    • Mapping energy generation pathways dependent on this complex

    • Identifying critical timepoints in aphid development when disruption would be most effective

    • Determining compensatory mechanisms that might develop in response to inhibition

  • RNAi-based approaches: Structural information guides the design of RNA interference strategies:

    • Selection of accessible regions in cyoC mRNA for siRNA targeting

    • Development of delivery systems that can reach Buchnera within bacteriocytes

    • Assessment of off-target effects through structural comparison with host proteins

  • Vaccine development: For agricultural protection, structural epitopes unique to Buchnera cytochrome o ubiquinol oxidase could form the basis of vaccines that stimulate plant immune responses against aphid feeding .

These approaches offer promising avenues for sustainable aphid control that specifically targets the obligate symbiosis without broad ecological impacts of conventional insecticides.

What role does genetic variation in cyoC play in Buchnera's adaptation to different aphid host genotypes?

Genetic variation in the cyoC gene plays a complex role in Buchnera's adaptation to different aphid host genotypes:

This genetic variation, though constrained by Buchnera's reduced genome, represents an important dimension of the ongoing coevolution between aphids and their obligate symbionts.

How do environmental stressors affect the expression and function of cytochrome o ubiquinol oxidase in the Buchnera-aphid symbiosis?

Environmental stressors significantly impact the expression and function of cytochrome o ubiquinol oxidase in the Buchnera-aphid symbiosis through multiple mechanisms:

  • Temperature effects:

    • Heat stress can denature proteins and disrupt membrane integrity, particularly problematic for membrane-bound complexes like cytochrome o ubiquinol oxidase

    • Cold stress may reduce enzyme kinetics and alter membrane fluidity

    • Buchnera lacks many heat-shock proteins found in free-living bacteria, potentially making its respiratory complexes more vulnerable to temperature fluctuations

  • Nutritional stress:

    • Host plant quality directly influences nutrient availability to both aphid and Buchnera

    • Limited resources may downregulate energy-intensive processes, potentially affecting oxidase expression

    • The density of bacteriocytes (which house Buchnera) varies significantly depending on host plant species, suggesting nutritional effects on symbiont population size and consequently on cytochrome o ubiquinol oxidase abundance

  • Chemical stressors:

    • Insecticide exposure triggers complex detoxification responses in aphids

    • Gene expression studies in Schizaphis graminum exposed to imidacloprid identified 2,782 responsive genes, potentially including indirect effects on Buchnera metabolism and respiratory function

    • Oxidative stress from environmental toxins may damage membrane proteins like cytochrome o ubiquinol oxidase

  • Viral interactions:

    • Virus presence (e.g., Cereal Yellow Dwarf Virus) influences gene expression in aphids approximately seven-fold less than biotype or time effects, but may still create metabolic demands affecting Buchnera function

    • Viruliferous aphids may show altered metabolic profiles that indirectly impact Buchnera's respiratory requirements

Understanding these environmental effects is critical for predicting symbiosis stability under changing climate conditions and agricultural practices.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.