Recombinant Buchnera aphidicola subsp. Schizaphis graminum Flagellar biosynthetic protein flhB (flhB)

Shipped with Ice Packs
In Stock

Description

Introduction to FlhB in Buchnera aphidicola

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Flagellar Biosynthetic Protein FlhB (flhB) is a genetically engineered protein derived from the flagellar gene cluster of the obligate aphid endosymbiont Buchnera aphidicola. Despite being nonmotile, Buchnera retains a partial flagellar system, including the flhB gene, which encodes a core component of the type III secretion system (T3SS) critical for assembling hook-basal-body (HBB) complexes . These structures are hypothesized to facilitate protein transport to maintain symbiosis with aphid hosts .

Research Findings on FlhB and Flagellar Systems in Buchnera

Genomic Context

  • Buchnera retains 26 flagellar genes, organized into five operons, but lacks genes for filament formation (e.g., fliC, flgL) and motility regulators (e.g., flhDC) .

  • The flhB gene is part of a conserved T3SS cluster essential for HBB assembly, alongside flhA, fliI, fliP, fliQ, and fliR .

Functional Insights

  • Expression Evidence: RT-PCR and proteomic studies confirm flhB transcription and translation in Buchnera .

  • Structural Role: FlhB contributes to HBB complexes, which densely cover Buchnera cell surfaces (~1,000 HBBs/cell) (Fig. 1) .

  • Hypothesized Function: HBBs may act as protein transporters to support symbiosis, compensating for Buchnera’s minimal transport machinery .

Table 2: Key Research Findings on FlhB

Study FocusKey ResultSource
Gene ConservationflhB shares 40% homology with Salmonella T3SS proteins
HBB Abundance~1,000 HBBs per Buchnera cell, visualized via TEM
Functional HypothesisHBBs may export symbiosis-related proteins to aphid hosts

Applications in Symbiosis Research

Recombinant FlhB enables:

  1. Mechanistic Studies: Investigating HBB assembly and T3SS function in Buchnera .

  2. Protein Interaction Analyses: Identifying host factors interacting with HBB complexes .

  3. Evolutionary Insights: Tracing the repurposing of flagellar systems in endosymbionts .

Future Directions

  • Structural Resolution: Cryo-EM studies to map FlhB’s role in HBB architecture.

  • Functional Validation: Knockdown experiments to test HBB’s role in nutrient exchange.

  • Comparative Genomics: Exploring flhB divergence across Buchnera strains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag requirement, please inform us. We will prioritize developing the specified tag type if possible.
Synonyms
flhB; BUsg_235; Flagellar biosynthetic protein FlhB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
flhB
Target Protein Sequence
MNHDINEEKTEQPTEHHIKKFRKKGETRYSRELNSLLILIFGLSNLWWSRYSIIFELKTI MFNSFNFNQNILTNQQNISLNFFFFIKKILIVFFPFFSFLICIIIIPPILFGGIKFNFTS LKLNFARLNLLHGLKKFFSFQIFIELFKTTLKLFIISCISIFYLWIYFYKILFLSTKNIS SSLLDGFNVIFYCCILIILGLIPIVILDVFWRQWSYYKKLKMTHQEIKDEFKEREGSPQI KARIRQQMKINLRRRMISDVPKADVIITNPIHYAIALKYDIHKMNAPKVIAKGIGATAMK IQKIALKNGIAIIASPSLARALYRYSEIGQYIPGPLYKAVAEILAWVWKVKKWKREGGIF PEKPKNISVPSELNVTGESND
Uniprot No.

Target Background

Function
This protein is essential for the formation of the rod structure within the basal body of the flagellar apparatus. In conjunction with FliI and FliH, it is believed to contribute to the export apparatus of flagellin.
Database Links
Protein Families
Type III secretion exporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and why is it significant for studying FlhB?

Buchnera aphidicola is an obligate intracellular bacterial endosymbiont that resides in specialized cells called bacteriocytes within the body cavity of aphids, including Schizaphis graminum (greenbug) . This symbiotic relationship is mutualistic, with Buchnera providing essential nutrients to aphids that are deficient in their phloem sap diet .

What makes Buchnera particularly interesting for studying FlhB is its highly reduced genome (approximately 416-641 kb depending on the strain) . Despite this extreme genomic reduction, Buchnera has maintained gene clusters coding for flagellum basal body structural proteins and flagellum type III export machinery, including flhB . This selective gene retention suggests these proteins serve important functions in the symbiotic relationship, despite Buchnera being non-motile .

What is the function of FlhB in bacterial systems?

FlhB is a highly conserved membrane protein component of the flagellar secretion system . It performs two primary functions:

  • It acts as part of the type III secretion system (T3SS) machinery in flagellar assembly, controlling protein export through the central channel of the flagellar structure .

  • FlhB plays an active role in regulating protein export by participating in substrate specificity switching—determining which flagellar proteins are secreted and when .

In bacteria like Salmonella typhimurium, FlhB undergoes autocleavage, which is essential for its function in the substrate specificity switch that regulates the ordered export of flagellar proteins . Studies suggest that the conformational flexibility of FlhB is crucial for its proper function .

Why does Buchnera aphidicola maintain flagellar genes despite being non-motile?

Despite being non-motile, Buchnera aphidicola has maintained flagellar basal body structural genes through millions of years of co-evolution with aphids . This seemingly contradictory retention has several hypothesized explanations:

  • The flagellar basal body may have been repurposed as a protein secretion system to facilitate host-symbiont interactions .

  • These structures might play a role in the nutrient exchange between the bacterium and its aphid host .

  • The flagellar apparatus could be involved in maintaining the structural integrity of the bacterium within the specialized host cells .

The high expression levels of these flagellar proteins and their presence in large numbers on Buchnera cells further support their functional importance, though no recognizable pathogenicity factors or secreted proteins have been identified in the Buchnera genome .

What are the recommended protocols for isolating Recombinant Buchnera aphidicola FlhB protein?

The isolation of the FlhB protein from Buchnera aphidicola requires specialized techniques due to the obligate intracellular nature of this endosymbiont. Based on current research protocols, the recommended approach involves:

  • Bacteriocyte isolation: Carefully dissect aphid abdomen to extract bacteriocytes containing Buchnera cells .

  • Membrane protein extraction: Use differential centrifugation to separate bacterial cells, followed by specific membrane protein extraction protocols that preserve the integrity of transmembrane proteins .

  • Flagellar basal body isolation: Apply a protocol similar to that described by Schepers et al. (2021) for isolating flagellum basal body complexes from the Buchnera membrane:

    • Purify Buchnera cells from aphid tissue

    • Lyse cells under gentle conditions

    • Use density gradient centrifugation to isolate membrane fractions

    • Apply detergent solubilization to extract membrane protein complexes

For recombinant expression, E. coli, yeast, baculovirus, or mammalian cell systems can be used as expression hosts . The purified protein should be stored at -20°C in a liquid form containing glycerol, with extended storage at -20°C or -80°C for maximum stability .

How can researchers verify the structural integrity and function of recombinant FlhB?

Verifying the structural integrity and function of recombinant FlhB requires multiple analytical approaches:

  • Structural integrity verification:

    • Use circular dichroism (CD) spectroscopy to assess secondary structure and stability, as performed with FlhB cytoplasmic fragments in previous studies

    • Apply differential scanning calorimetry to evaluate thermal stability

    • Utilize size exclusion chromatography to confirm proper folding and oligomeric state

  • Functional verification:

    • Assess autocleavage capability using SDS-PAGE and western blotting

    • Evaluate protein-protein interactions with other flagellar system components

    • Perform in vitro protein export assays to test substrate specificity

  • Complementation studies:

    • Express recombinant FlhB in FlhB-deficient bacterial strains to test for functional restoration

    • Cross-species complementation experiments can provide insights into conserved functional domains

Cross-species complementation studies have shown that replacing the flhB gene in Salmonella typhimurium with the flhB gene from the distantly related bacterium Aquifex aeolicus reduces motility, but motility can be partially restored by mutations in the cytoplasmic domain, suggesting the importance of conformational flexibility .

What techniques are available for studying FlhB interactions with other flagellar proteins?

Several techniques are available for investigating FlhB interactions with other flagellar proteins:

  • Protein-protein interaction assays:

    • Co-immunoprecipitation (Co-IP) to capture protein complexes

    • Bacterial two-hybrid systems for in vivo interaction detection

    • Surface plasmon resonance (SPR) for binding kinetics determination

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Structural biology approaches:

    • X-ray crystallography of FlhB alone or in complex with interaction partners

    • Cryo-electron microscopy to visualize larger complexes

    • Nuclear magnetic resonance (NMR) spectroscopy for dynamic interaction studies

  • Crosslinking and mass spectrometry:

    • Chemical crosslinking followed by mass spectrometry to identify interacting proteins

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

Studies of FlhB in other bacterial systems have revealed interactions with proteins such as FliK, which is involved in the substrate specificity switch . In Buchnera, the potential interaction partners may differ due to its reduced genome, making the study of these interactions particularly interesting.

How has the function of FlhB evolved in Buchnera compared to free-living bacteria?

The evolution of FlhB function in Buchnera represents a fascinating case study in protein repurposing during endosymbiont evolution:

  • Comparative genomic analysis:
    Studies comparing the flhB gene across different Buchnera strains show it has been maintained despite extensive genome reduction . In free-living bacteria like Salmonella, FlhB functions primarily in flagellar assembly for motility, while in Buchnera, which is non-motile, its retention suggests alternative functions .

  • Structural adaptations:
    Sequence analysis reveals that Buchnera FlhB has maintained core functional domains despite accumulating mutations . The protein likely retains its membrane topology and autocleavage capability, but may have evolved altered substrate specificity.

  • Functional divergence:
    In Buchnera aphidicola from various aphid hosts (including Acyrthosiphon pisum, Schizaphis graminum, Baizongia pistaciae, and Cinara cedri), transport functions have been shaped by distinct selective constraints occurring in different Aphididae lineages . Transport in Buchnera is assured by low transporter diversity compared to free-living bacteria, being mostly based on a few general transporters, some of which probably lost their substrate specificity .

This evolutionary repurposing may represent a case where a flagellar protein has been co-opted for symbiosis-specific functions, potentially related to the exchange of nutrients or signals between Buchnera and its aphid host.

What is the impact of FlhB mutations on the Buchnera-aphid symbiotic relationship?

The impact of FlhB mutations on the Buchnera-aphid symbiotic relationship remains largely unexplored, but several hypotheses can be formulated based on current understanding:

  • Potential disruption of nutrient exchange:
    If FlhB is involved in the transport of essential nutrients between Buchnera and the aphid host, mutations could impair this exchange, potentially affecting aphid growth, development, and reproduction .

  • Altered host-symbiont recognition:
    FlhB may play a role in maintaining the specific recognition between Buchnera and host cells. Mutations could potentially disrupt this recognition, affecting the establishment or maintenance of the symbiosis .

  • Changes in Buchnera membrane integrity:
    As a membrane protein, FlhB contributes to the structural integrity of the Buchnera membrane system. Mutations might affect membrane properties, potentially impacting the bacterium's survival within host cells .

Experimental approaches to study these effects could include:

  • Creation of point mutations in the flhB gene using recombinant Buchnera proteins and assessing their impact on protein function in vitro

  • Development of aphid lines with Buchnera containing modified flhB genes (though technically challenging due to the obligate nature of the symbiosis)

  • Comparative studies of natural variations in the flhB gene across different Buchnera-aphid systems to correlate with phenotypic differences in symbiotic efficiency

How does FlhB contribute to the unique membrane transport system in Buchnera aphidicola?

FlhB's role in Buchnera's membrane transport system is particularly intriguing given the unusual membrane characteristics of this endosymbiont:

  • Membrane architecture variations:
    Buchnera from different aphid hosts exhibit distinct membrane systems. Buchnera from A. pisum and S. graminum have a three-membraned system, B. pistaciae appears to possess a unique double membrane system (having lost all outer-membrane integral proteins), while Buchnera from C. cedri maintains the ancestral three-membraned system despite having an extremely poor repertoire of transporters .

  • Compensatory role in reduced transporter diversity:
    Buchnera exhibits an astonishing lack of inner-membrane importers and maintains transport primarily through a few general transporters . The FlhB protein may compensate for this reduction by assuming broader substrate specificity or multiple functions.

  • Integration with host transport mechanisms:
    Transmission electron microscopic observations and confocal microscopic analysis have revealed that Buchnera does not show typical structures and properties observed in integrated organelles . FlhB may serve as a critical interface in this non-typical integration, potentially facilitating direct or indirect communication with host transport systems.

This unique context makes FlhB particularly interesting for understanding how protein function can adapt to novel cellular environments during the evolution of endosymbiosis.

Comparative analysis of FlhB protein across different Buchnera strains

Table 1: FlhB Characteristics in Different Buchnera aphidicola Strains

Buchnera Strain (Host)Genome SizeFlhB Gene NameProtein LengthConserved DomainsMembrane System
B. aphidicola (A. pisum)641 kbflhBCompleteType III secretion, autocleavageThree-membraned
B. aphidicola (S. graminum)~640 kbflhB, BUsg_235Complete/PartialType III secretion, autocleavageThree-membraned
B. aphidicola (B. pistaciae)~618 kbflhBModifiedType III secretionDouble membrane
B. aphidicola (C. cedri)416 kbflhBReducedBasic type III secretionThree-membraned

This table illustrates the variation in FlhB characteristics across different Buchnera strains, showing how genome size reduction has affected this protein while maintaining its core functionality . The correlation between membrane system architecture and FlhB characteristics suggests co-evolution of these features during Buchnera's adaptation to different aphid hosts.

Functional domains and critical residues in Buchnera FlhB protein

Table 2: Key Functional Domains and Residues in FlhB Protein

Domain/RegionAmino Acid PositionFunctionConservation in BuchneraNotes
N-terminal transmembrane1-200 (approx.)Membrane anchoringHighly conservedContains multiple transmembrane helices
Autocleavage site200-220 (approx.)Self-cleavage for functionConserved in most strainsNPTH motif commonly present
C-terminal cytoplasmic220-360 (approx.)Protein-protein interactionsVariable conservationShows highest mutation rate
FliK interaction regionWithin C-terminalSubstrate switchingReduced conservationMay have altered specificity
Export gate interfaceN-terminal regionChannel formationHighly conservedCritical for type III secretion

This table summarizes current knowledge about the functional domains and critical residues in FlhB, highlighting the areas that are likely essential for its function in Buchnera . The varying degrees of conservation across different regions suggest differential selective pressures, with membrane-anchoring functions being more essential than some protein-protein interaction specificities.

Impact of FlhB on flagellar protein expression and secretion

Studies on FlhB in related bacteria have provided insights into its role in regulating flagellar protein expression and secretion, which may parallel its function in Buchnera:

Table 3: Experimental Findings on FlhB Function in Flagellar Protein Regulation

Study SystemExperimental ApproachFindingsRelevance to Buchnera
L. monocytogenesFlhB deletion mutantAbolished FlaA expression, reduced FliY and FliM expressionSuggests FlhB regulates flagellar protein synthesis beyond secretion
Salmonella typhimuriumCross-species complementationFlhB conformational flexibility important for functionMay explain conservation of certain FlhB features in Buchnera
Buchnera aphidicolaProtein isolation and proteomic analysisFlagellar basal body proteins enriched in Buchnera membraneConfirms expression and localization of flagellar structures in Buchnera
E. coli FlhC knockoutMetabolic flux analysisIncreased fluxes toward pentose phosphate and TCA cycle pathwaysSuggests potential metabolic impact of flagellar protein regulation

In Listeria monocytogenes, FlhB deletion abolished the expression of FlaA completely and reduced the expression of cytoplasmic proteins FliY and FliM, while not affecting FlhF and regulatory factors MogR and GmaR . This suggests that FlhB functions extend beyond mere secretion to regulation of protein expression, which could be particularly significant in the context of Buchnera's reduced genome and limited regulatory capacity.

What are the limitations of current techniques for studying Buchnera FlhB function?

Several significant technical challenges currently limit the comprehensive study of Buchnera FlhB function:

  • Cultivation limitations:
    Buchnera aphidicola is an obligate endosymbiont that cannot be cultured outside its aphid host, making traditional microbiological techniques inapplicable . This necessitates working with either:

    • Intact aphid-Buchnera systems, which introduce host variables

    • Isolated Buchnera cells, which have limited viability

    • Recombinant proteins expressed in heterologous systems, which may not fully recapitulate native function

  • Genetic manipulation barriers:
    There are currently no established methods for direct genetic manipulation of Buchnera, preventing:

    • Gene knockout studies

    • Site-directed mutagenesis

    • Reporter gene insertion for in vivo visualization

  • Structural analysis challenges:
    The membrane-embedded nature of FlhB poses specific difficulties for structural studies:

    • Protein crystallization is complicated by multiple transmembrane domains

    • Detergent requirements may alter native conformations

    • Low expression levels in Buchnera limit material availability for analysis

These limitations necessitate creative experimental approaches, such as the isolation of native protein complexes and their characterization through mass spectrometry, as demonstrated by Schepers et al. .

How might genetic engineering approaches advance our understanding of FlhB function?

Despite current limitations, several genetic engineering approaches could advance our understanding of FlhB function in Buchnera:

  • Heterologous expression systems:

    • Express Buchnera FlhB in model organisms like E. coli with FlhB deletions to assess functional complementation

    • Create chimeric FlhB proteins combining domains from Buchnera and free-living bacteria to identify functionally critical regions

    • Develop conditional expression systems to study dose-dependent effects

  • Site-directed mutagenesis of recombinant proteins:

    • Generate point mutations in conserved domains to assess their impact on function

    • Create truncated versions to identify minimal functional units

    • Introduce fluorescent or affinity tags for interaction studies

  • Advanced microscopy techniques:

    • Develop specific antibodies against Buchnera FlhB for immunolocalization

    • Apply super-resolution microscopy to visualize FlhB distribution in intact Buchnera cells

    • Use correlative light and electron microscopy to link localization with ultrastructural features

These approaches could provide valuable insights despite the inability to directly manipulate the Buchnera genome, potentially revealing how this protein has been repurposed during the evolution of endosymbiosis.

What is the potential significance of FlhB research for understanding bacterial evolution and host-microbe interactions?

Research on Buchnera FlhB has broader implications for understanding:

  • Genome reduction and functional repurposing:
    Buchnera has undergone extreme genome reduction while maintaining specific gene sets like the flagellar apparatus . Understanding why FlhB has been retained could reveal important principles about:

    • Essential functions in minimal bacterial genomes

    • The repurposing of existing structures for new functions during evolution

    • Constraints that shape genome evolution in host-associated bacteria

  • Host-symbiont communication mechanisms:
    If FlhB is involved in host-symbiont interactions, it could provide insights into:

    • How intracellular bacteria communicate with host cells

    • The molecular basis of specificity in long-term symbiotic associations

    • Convergent evolution of interaction mechanisms across different symbiotic systems

  • Applications in synthetic biology:
    Understanding how Buchnera has repurposed the flagellar apparatus could inspire:

    • New approaches for engineering minimal bacterial genomes

    • Development of novel protein secretion systems

    • Strategies for establishing artificial symbioses with defined functions

The study of proteins like FlhB in reduced-genome symbionts provides a window into the molecular mechanisms that enable intimate biological partnerships, potentially informing both fundamental evolutionary theory and applied research in synthetic biology and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.