Recombinant Buchnera aphidicola subsp. Schizaphis graminum Flagellar biosynthetic protein fliP (fliP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's intrinsic stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
fliP; BUsg_075; Flagellar biosynthetic protein FliP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-379
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
fliP
Target Protein Sequence
MENNVYSQIAPSIFKRIFDDTNIFHVMSSLFGMLLLVLILIWILKKISLLKINKNNYFIK TIDRMSLGPNESIVIIKIEEIKLVLGITKNHITHLYTLSSDVKDDVVDKKKEVILPTKNF NDSLKNFAKIFWKKTMFYRIIPLFFLFLFCPLVYADIPGPTSHILRDGSQTWSLPVQTLI FLTSLTFLPAFLLMMTSFTRIIIVFGLLRNALGTPYAPPNQILLGLALFLTFFIMSPTFD QVYKEAYLPFSQEKINMDEAIIKGAVPLKKFMLNQTRNSDLELFSKLAHISSYKNKDEIP MRILLPSFITSELKTAFQIGFTIFIPFLIIDLVVASVLMALGMMMVPPSTISLPFKLMLF VLVDGWQLLVTSLSQSFKI
Uniprot No.

Target Background

Function
Plays a role in the flagellum-specific transport system.
Database Links
Protein Families
FliP/MopC/SpaP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is Buchnera aphidicola and its significance in symbiotic research?

Buchnera aphidicola is an endosymbiotic bacterium found in aphids that has evolved through extensive genome reduction, making it unable to survive autonomously outside its host. Despite its reduced genome (approximately 618 kb), Buchnera plays a crucial role in supplying essential nutrients lacking in the aphid's phloem-sap diet, establishing a nutritional mutualism that has persisted for millions of years . This symbiotic relationship was traditionally viewed as a one-to-one obligate association, though recent research has revealed cases where Buchnera is complemented by additional symbionts in certain aphid lineages . The genomic stasis observed in Buchnera, with nearly perfect gene-order conservation, indicates that genomic stability coincided closely with the establishment of the symbiosis approximately 200 million years ago . This system provides an exceptional model for studying genome reduction, host-symbiont coevolution, and the molecular mechanisms underlying endosymbiotic relationships in insects.

What is the flagellar biosynthetic protein FliP and its function in Buchnera aphidicola?

The flagellar biosynthetic protein FliP is a component of the flagellar export apparatus in bacteria, typically involved in the assembly of flagellar structures necessary for bacterial motility. In Buchnera aphidicola, despite being nonmotile, the bacterium retains clusters of flagellar genes, including fliP, while lacking the late genes necessary for complete flagellar assembly such as flagellin . The amino acid sequence of Buchnera FliP contains transmembrane domains that integrate into cellular membranes, as evidenced by its hydrophobic regions . Interestingly, experimental evidence has shown that flagellar genes in Buchnera are actually transcribed and translated, with hook-basal-body (HBB) complexes observed on the cell surface . The retention and expression of fliP in a nonmotile bacterium suggest that this protein may serve alternative functions in the symbiotic context, potentially contributing to protein transport mechanisms that support the symbiotic relationship rather than cell motility.

How do researchers obtain and work with recombinant Buchnera FliP protein?

Recombinant Buchnera aphidicola FliP protein is typically expressed in E. coli expression systems with fusion tags (commonly His-tags) to facilitate purification . The full-length FliP protein (amino acids 1-379 for the Schizaphis graminum strain) can be expressed with appropriate expression vectors and purified using affinity chromatography . After purification, the protein is generally stored as a lyophilized powder or in a Tris/PBS-based buffer containing 6% trehalose or 50% glycerol at pH 8.0 to maintain stability . For reconstitution, researchers typically centrifuge the vial briefly before opening and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . To prevent protein degradation during experimental procedures, it's recommended to avoid repeated freeze-thaw cycles by creating working aliquots stored at 4°C for short-term use (up to one week) and maintaining long-term stocks at -20°C or -80°C . These methodological considerations ensure the structural integrity and functional activity of the recombinant protein during experimental applications.

How does the hook-basal-body (HBB) complex structure in Buchnera differ from typical bacterial flagella?

The flagellar structure in Buchnera aphidicola represents a striking example of evolutionary repurposing of cellular machinery. Unlike complete bacterial flagella, which consist of basal body, hook, and filament components, Buchnera possesses only hook-basal-body (HBB) complexes without the external filament structure . Microscopic examination has revealed hundreds of these HBB complexes covering the cell surface of Buchnera, suggesting a density and distribution pattern distinct from typical motile bacteria . The genome of Buchnera retains genes coding for proteins that form the hook and basal body structures but lacks genes encoding filament proteins, particularly flagellin . This selective retention of flagellar structural genes indicates strong evolutionary pressure to maintain the HBB complex while eliminating components unnecessary for the symbiotic lifestyle. The abundance and conservation of these incomplete flagellar structures across Buchnera strains that diverged 80-150 million years ago suggest these structures fulfill critical functions beyond motility, potentially as specialized protein transport systems adapted to the unique requirements of the endosymbiotic relationship .

What experimental evidence supports alternative functions of HBB complexes in Buchnera?

The evidence for non-motility functions of flagellar structures in Buchnera comes from multiple experimental approaches. Genome analysis initially revealed the retention of specific flagellar genes coding for hook and basal body components while losing genes necessary for filament formation, suggesting selective pressure to maintain these structures for purposes other than motility . Direct microscopic visualization confirmed the physical presence of hundreds of HBB complexes on the Buchnera cell surface, demonstrating that these genes are not merely vestigial but are actively expressed and assembled into complex structures . Transcriptomic analysis using microarray technology has shown that these flagellar genes are actively transcribed, with expression patterns potentially regulated by environmental conditions or developmental stages of the host aphid . The hypothesis that these structures may function as protein transporters is supported by the observation that protein export pathways in bacteria can utilize components of the flagellar apparatus, and the abundance of HBB complexes would provide sufficient capacity for significant transport activity to support the symbiotic relationship . These multiple lines of evidence collectively suggest that Buchnera has repurposed its flagellar apparatus for specialized functions in the context of its endosymbiotic lifestyle.

What techniques are used to visualize and localize FliP and flagellar structures in Buchnera?

Researchers employ several complementary techniques to visualize and localize FliP and flagellar structures in Buchnera aphidicola. Fluorescent in situ hybridization (FISH) microscopy has proven particularly valuable for localizing symbionts within bacteriocytes and can be adapted to target specific proteins like FliP using appropriately labeled antibodies or probes . Immunogold electron microscopy provides higher resolution visualization, allowing researchers to precisely localize FliP within the flagellar apparatus by using antibodies against recombinant FliP conjugated to gold particles . For studying spatial relationships between multiple symbiont species in dual symbiotic systems, fluorescent probes with different emission spectra can be used to simultaneously visualize the distribution of Buchnera and secondary symbionts within host tissues . Confocal microscopy enables three-dimensional reconstruction of symbiont arrangements within bacteriocytes, while super-resolution microscopy techniques can further enhance visualization of flagellar structures beyond the diffraction limit of conventional light microscopy. These visualization techniques are often complemented by molecular approaches, such as qPCR and microarray analysis, to correlate protein localization with gene expression patterns under different experimental conditions .

How can researchers study the functional role of FliP in protein transport?

To investigate FliP's putative role in protein transport, researchers can employ several methodological approaches. Recombinant expression systems can be used to produce modified versions of FliP with targeted mutations in domains predicted to be involved in protein transport, followed by functional complementation studies to assess transport efficiency . Fluorescent reporter fusion proteins can be designed to track potential cargo molecules transported through the HBB complex, with fluorescence microscopy or FRET (Förster resonance energy transfer) techniques used to visualize transport processes in real-time. Proteomic approaches, including co-immunoprecipitation with antibodies against recombinant FliP followed by mass spectrometry, can identify interaction partners that might represent transported cargo or other components of the transport machinery. Comparative studies between Buchnera strains with different numbers or distributions of HBB complexes can correlate structural abundance with transport capacity. In vitro transport assays using purified HBB complexes incorporated into liposomes with fluorescently labeled potential cargo molecules could provide direct evidence of transport activity. Additionally, transcriptomic and metabolomic analyses of both Buchnera and host aphid tissues under conditions where transport is stimulated or inhibited can reveal the broader physiological context and importance of FliP-mediated transport in maintaining the symbiotic relationship.

What expression systems are optimal for recombinant Buchnera FliP production?

E. coli expression systems have proven effective for recombinant production of Buchnera FliP protein, offering several advantages for research applications . The recommended expression strategy involves using full-length fliP gene sequences (1-379 amino acids for Buchnera aphidicola subsp. Schizaphis graminum) with N-terminal His-tags to facilitate purification through affinity chromatography . For optimal expression, codon optimization may be necessary to account for differences in codon usage between Buchnera and E. coli. Temperature and induction conditions require careful optimization, as lower temperatures (15-25°C) during induction often improve the solubility of membrane proteins like FliP. Purification is typically performed under native conditions to maintain protein structure, though the presence of multiple transmembrane domains in FliP may necessitate the use of appropriate detergents during extraction and purification. After purification, the protein should be stored in a Tris/PBS-based buffer with stabilizing agents such as 6% trehalose or 50% glycerol at pH 8.0 . For experimental applications, reconstitution protocols should be carefully followed, including brief centrifugation before opening vials and reconstitution in deionized sterile water to concentrations of 0.1-1.0 mg/mL . These methodological considerations ensure the production of functional recombinant FliP suitable for structural studies, antibody production, and functional assays.

How does FliP from Buchnera compare with homologs from other bacterial species?

The FliP protein from Buchnera aphidicola shows both conservation and divergence when compared with homologs from other bacterial species, reflecting its evolutionary history and specialized function. The amino acid sequence of Buchnera FliP (e.g., from Schizaphis graminum strain) contains conserved transmembrane domains characteristic of this protein family, though with sequence modifications that may reflect adaptation to the endosymbiotic lifestyle . When compared with the FliP protein from Borrelia burgdorferi (254 amino acids), Buchnera FliP is longer (379 amino acids), suggesting potential structural or functional adaptations . Both proteins maintain the core hydrophobic regions necessary for membrane integration, indicating conservation of fundamental structural elements despite sequence divergence. Comparative sequence analysis of FliP across different Buchnera strains reveals high conservation, reflecting the genomic stasis that characterizes these endosymbionts since their divergence 80-150 million years ago . This conservation contrasts with the extensive reductive evolution observed in many other Buchnera genes, suggesting strong selective pressure to maintain FliP functionality. The retention of similar flagellar gene clusters across different Buchnera strains, despite ongoing gene loss in other functional categories, further supports the hypothesis that these genes serve essential functions in the endosymbiotic context .

What can we learn about symbiont evolution from studying flagellar proteins in Buchnera?

The study of flagellar proteins like FliP in Buchnera provides valuable insights into symbiont evolution and the repurposing of cellular machinery in endosymbiotic contexts. The retention of flagellar genes amid extensive genome reduction demonstrates how selective pressures in symbiosis can preserve specific functional modules while eliminating others . This selective retention pattern suggests that evolutionary processes in endosymbionts are not simply driven by random genetic drift but also by functional constraints related to the symbiotic lifestyle. The observation that Buchnera maintains genes for hook-basal-body complexes while losing those for flagellar filaments illustrates how modular bacterial systems can be partially retained and repurposed for new functions . In the context of co-obligate symbioses, where Buchnera is complemented by additional symbionts in some aphid lineages, studying flagellar gene retention patterns across these systems can reveal how metabolic interdependencies evolve . The discovery that small genome reductions affecting a few key genes can promote the establishment of co-obligate symbiotic partners highlights the fragility of even long-established symbiotic systems . Comparative analyses across different aphid subfamilies have revealed that dual symbioses have evolved independently at least six times, often involving partners that evolved from facultative symbiotic taxa, providing a natural experiment in convergent evolution of complex symbiotic systems .

Comparative Amino Acid Sequence Analysis of FliP Proteins

CharacteristicBuchnera aphidicola (S. graminum) FliPBorrelia burgdorferi FliP
Length379 amino acids254 amino acids
UniProt IDQ8KA37Q44763
Expression vectorE. coliE. coli
TagHis-tag (N-terminal)His-tag (N-terminal)
Storage bufferTris-based buffer, 50% glycerolTris/PBS-based buffer, 6% Trehalose, pH 8.0
Key domainsMultiple transmembrane domainsMultiple transmembrane domains
SolubilityRequires detergents for extractionRequires detergents for extraction
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Deionized sterile water (0.1-1.0 mg/mL)
Storage temperature-20°C/-80°C-20°C/-80°C

Experimental Applications of Recombinant FliP Protein

ApplicationMethodologyExpected ResultsLimitations
Antibody productionImmunization with purified recombinant proteinSpecific antibodies for immunolocalizationCross-reactivity with similar proteins
Structural studiesX-ray crystallography or cryo-EMProtein structure determinationCrystallization challenges with membrane proteins
Protein-protein interactionPull-down assays, co-immunoprecipitationIdentification of binding partnersNon-specific interactions
Functional assaysReconstitution in liposomesTransport activity measurementArtificial membrane environment
Localization studiesImmunogold electron microscopyPrecise cellular localizationSample preparation artifacts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.