Recombinant Buchnera aphidicola subsp. Schizaphis graminum Lipoprotein-releasing system transmembrane protein LolC (lolC)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of lolC Protein

The lolC protein from Buchnera aphidicola subsp. Schizaphis graminum represents a critical component of the lipoprotein trafficking machinery. It belongs to the ABC-4 integral membrane protein family, specifically within the LolC/E subfamily . With a length of 399 amino acids and a molecular mass of approximately 46.5 kDa, this transmembrane protein exhibits specific structural characteristics that enable its function in lipoprotein transport . The protein's ability to facilitate lipoprotein release is dependent on both the sorting-signal (specifically the absence of an aspartic acid residue at position 2 of the mature lipoprotein) and the presence of another protein component known as LolA .

Biochemical Properties

The biochemical characteristics of recombinant lolC are summarized in the following table:

PropertyValue
OrganismBuchnera aphidicola subsp. Schizaphis graminum
Protein familyABC-4 integral membrane protein family, LolC/E subfamily
Length399 amino acids
Molecular mass46.5 kDa
Cellular locationInner membrane
FunctionLipoprotein release from inner to outer membrane

These properties collectively contribute to the protein's ability to function effectively within the bacterial membrane environment, where it participates in the critical process of lipoprotein trafficking.

Functional Mechanisms of lolC

The lolC protein operates as part of an ATP-dependent transport system that is essential for bacterial membrane integrity and function. In Gram-negative bacteria including Buchnera aphidicola, lipoproteins destined for the outer membrane must traverse the periplasmic space after their initial synthesis and processing at the inner membrane . The Lol system, which includes lolC, facilitates this transport process through a series of coordinated protein interactions.

Role in the Lipoprotein Transport Pathway

Within the lipoprotein transport pathway, lolC functions as a transmembrane component that works in concert with other proteins to form a complete transport apparatus. The system begins with the recognition of lipoproteins that contain the appropriate sorting signal, notably the absence of an aspartic acid at position 2 of the mature lipoprotein . This recognition event initiates the ATP-dependent release of the lipoprotein from the inner membrane.

The lolC protein, along with its partner proteins, participates in the formation of a complex that spans the inner membrane. This complex utilizes ATP hydrolysis to power the extraction of lipoproteins from the inner membrane, after which they are transferred to LolA, a periplasmic chaperone . LolA subsequently shuttles the lipoprotein across the periplasmic space to the outer membrane, where additional components of the Lol system complete the insertion process.

Relationship with Other Lol System Components

The search results indicate that lolC does not function in isolation but rather as part of an integrated system. The Lol system in Gram-negative bacteria typically includes multiple components, with lolC, lolD, and lolE forming the inner membrane complex . The absence of any of these components can compromise the integrity of the lipoprotein transport system, potentially affecting bacterial viability and function.

Interestingly, genomic analysis across different Buchnera strains reveals that while lolC is present in some strains (such as BAp and BSg), it has been lost in others (BBp, BCc, and BCt) . This pattern of gene retention and loss provides valuable insights into the evolutionary history and functional importance of the Lol system in these endosymbiotic bacteria.

Evolutionary Context and Genomic Analysis

Buchnera aphidicola represents a fascinating case study in bacterial evolution due to its long-standing endosymbiotic relationship with aphids. This association is estimated to have begun approximately 100 to 200 million years ago, leading to significant genomic reduction and specialization in Buchnera . The evolutionary trajectory of lolC within this context offers important insights into the adaptation of essential cellular processes during endosymbiotic evolution.

Comparative Genomics of lolC Across Buchnera Strains

Analysis of gene presence and absence across different Buchnera strains reveals a pattern of selective gene retention and loss. The following table summarizes the status of lolC and related genes across various Buchnera strains:

GeneBApBSgBBpBCcBCt
lolC++---
lolD++---
lolEψ+---

Note: "+" indicates gene presence, "-" indicates gene absence, and "ψ" indicates a pseudogene

This pattern suggests that while the Lol system components are retained in some Buchnera strains, they have been lost in others. The BSg strain (Buchnera aphidicola subsp. Schizaphis graminum) has maintained both lolC and lolD, with a functional lolE, whereas these genes are completely absent in BBp, BCc, and BCt strains . This differential retention pattern may reflect varying selective pressures related to the specific host-symbiont relationships of different aphid species.

Genome Reduction and Functional Implications

The genome of Buchnera aphidicola has undergone substantial reduction compared to its free-living bacterial ancestors. The BSg strain possesses a genome of approximately 653,001 bp, containing 597 genes in total . This genomic streamlining has resulted in the loss of many genes considered essential in other bacteria, while retaining those necessary for the endosymbiotic lifestyle.

Recombinant Production and Research Applications

The production of recombinant lolC protein enables detailed biochemical and structural studies that would be difficult to perform using naturally occurring protein isolated from Buchnera aphidicola. Recombinant expression systems, particularly using Escherichia coli as a host, provide a practical method for generating sufficient quantities of purified protein for various research applications.

Expression Systems and Purification Strategies

While the search results do not provide specific details about the expression and purification of recombinant lolC from Buchnera aphidicola subsp. Schizaphis graminum, information about a related protein from Buchnera aphidicola subsp. Acyrthosiphon pisum suggests typical approaches. This recombinant protein is expressed in E. coli with an N-terminal His-tag to facilitate purification . Similar strategies could be applied to the BSg lolC protein.

The recombinant protein is typically produced as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis . Reconstitution recommendations include using deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of glycerol (5-50% final concentration) for long-term storage at -20°C/-80°C .

Biological Significance in Buchnera-Aphid Symbiosis

The function of lolC within Buchnera aphidicola must be understood in the context of the bacterium's endosymbiotic relationship with aphids. Buchnera provides essential nutrients, particularly amino acids, to its aphid host, while receiving protection and a stable environment within specialized host cells called bacteriocytes.

Role in Membrane Integrity and Symbiotic Function

Lipoproteins are crucial components of bacterial membranes, contributing to membrane stability, nutrient transport, and cellular signaling . In the context of Buchnera's endosymbiotic lifestyle, proper membrane organization is essential for facilitating the exchange of metabolites between the bacterium and its host. The lolC protein, by ensuring the correct localization of outer membrane lipoproteins, likely plays an indirect but significant role in maintaining the functional interface between Buchnera and its aphid host.

The selective retention of lolC in the BSg strain suggests that this function remains important despite the reduced genome and specialized lifestyle. This retention contrasts with the pattern observed in some other Buchnera strains, which have lost lolC along with many other genes, suggesting alternative adaptations for membrane organization or reduced requirements for outer membrane complexity.

Implications for Bacterial Adaptation to Endosymbiosis

The pattern of gene retention and loss across Buchnera strains provides insights into the evolutionary processes shaping these endosymbiotic bacteria. The maintenance of lolC in BSg, combined with its loss in other strains, suggests divergent evolutionary trajectories even within the same bacterial genus. These differences may reflect adaptations to the specific requirements of different aphid host species or lineages.

The study of proteins like lolC contributes to our broader understanding of how bacteria adapt to endosymbiotic lifestyles through genome reduction and functional specialization. By focusing on essential cellular processes such as membrane organization and protein trafficking, researchers can gain insights into the minimal requirements for bacterial life and the adaptations that enable long-term symbiotic relationships.

Current Research and Future Perspectives

Research on lolC and related proteins in Buchnera aphidicola contributes to multiple fields, including evolutionary biology, bacterial physiology, and symbiosis research. The availability of recombinant lolC enables more detailed studies of its structure, function, and potential applications.

Comparative Analysis with Other Bacterial Systems

Comparative studies of lolC across different bacterial species, including both free-living and endosymbiotic bacteria, could reveal adaptations specific to the endosymbiotic lifestyle. Understanding how essential systems like lipoprotein transport have evolved in the context of genome reduction and host adaptation may provide broader insights into bacterial evolution and the mechanisms underlying symbiotic relationships.

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preferred format when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please let us know, and we will prioritize the development of your desired tag.
Synonyms
lolC; BUsg_284; Lipoprotein-releasing system transmembrane protein LolC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-399
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
lolC
Target Protein Sequence
MYKPIYIFIGLRYLWNPYLPNFKKIIIILSILGIGIGISSTIITISIMNGFQNKFKNDIL SFIPHIIITNKNRNINKLNFPKETLKLKNVEEITDFISKKVIIENKNEINIGEIIGINIK NEKNLENYNIKKFLHTLHSRKYNAIIGSELAKKMHVNINDQIKLIVLPISKKKFLQNDLN IKLFKITGIFSTNSEIDEYQILINKKNALNFLNYNKNYITGWKIKLKDPFILNIQKIKKL NKNFIILDWKTKKGELFKAMKIEKYIMLFFFILILLVSSFNIVISLTMNVLDKKNNISIF QSQGLSRYKIMLIFIILGSTISIVGNSFGTIISIILIFQKDFLNFLIKIFFIDIEIPIEI SLIQILTINITFIFLTILSTLYPIWYAIKSTPSRILSDE
Uniprot No.

Target Background

Function
LolC is a transmembrane protein that plays a role in the ATP-dependent transport system responsible for the release of lipoproteins targeted to the outer membrane from the inner membrane in Buchnera aphidicola subsp. Schizaphis graminum. This release process is dependent on the sorting signal (absence of an Asp at position 2 of the mature lipoprotein) and the involvement of LolA.
Database Links
Protein Families
ABC-4 integral membrane protein family, LolC/E subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.