Recombinant Buchnera aphidicola subsp. Schizaphis graminum Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Lipoprotein signal peptidase (lspA) is a membrane-bound enzyme (EC 3.4.23.36) essential for processing bacterial lipoproteins. In Buchnera aphidicola subsp. Schizaphis graminum (strain Sg), the recombinant form is produced in E. coli or similar systems, retaining its native enzymatic activity . Key features include:

  • Molecular Weight: ~18 kDa (160 amino acids)

  • Catalytic Function: Cleaves N-terminal signal peptides from prolipoproteins, a prerequisite for bacterial membrane localization .

  • Storage: Stable at -20°C in Tris-based buffer with 50% glycerol; sensitive to repeated freeze-thaw cycles .

Functional Role in Buchnera Symbiosis

Buchnera aphidicola relies on lspA to sustain its symbiotic relationship with aphids:

  • Nutrient Provisioning: Buchnera compensates for the aphid’s phloem-sap diet by synthesizing essential amino acids . lspA ensures proper lipoprotein maturation, vital for nutrient transport and membrane integrity .

  • Genomic Reduction: Despite massive gene loss in Buchnera (genome size ~0.64 Mb), lspA is retained, underscoring its indispensability .

Table 1: Functional Partners of lspA in Buchnera

ProteinFunctionInteraction Score
ileSIsoleucyl-tRNA synthetase0.917
ribFFMN/FAD biosynthesis0.787
lepBSignal peptidase I0.770
lgtProlipoprotein diacylglyceryl transferase0.675
secYProtein translocation channel0.498

Data source: STRING interaction database .

Research Applications

Recombinant lspA serves as a tool for:

  1. Symbiosis Studies: Investigating Buchnera’s dependency on minimalistic transport systems .

  2. Enzyme Characterization: Analyzing substrate specificity using mutagenesis .

  3. Comparative Genomics: Contrasting lspA across Buchnera strains (e.g., S. graminum vs. A. pisum) to trace evolutionary adaptations .

Evolutionary and Ecological Insights

  • Dual Symbioses: In some aphid lineages, Buchnera’s metabolic deficiencies (e.g., tryptophan biosynthesis) are compensated by secondary symbionts like Serratia symbiotica, yet lspA remains conserved .

  • Genome Stability: Despite recurrent gene loss events, lspA’s preservation highlights its non-redundant role in maintaining bacterial viability .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If dry ice shipping is preferred, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal results, briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; BUsg_141; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
lspA
Target Protein Sequence
MKRKYYWIYINIIFFIITVDFYSKKWILNHLNIYEKQKVFFILNLFHVHNFGAAFSILSD QNGWQKYFLLIFSIIIILAIIKIMIKFKKKDKNKILSYSLILAGAIGNLIDRINYGFVID FIDLHFKSWHFATFNIADFSIFIGMIMIIKKNYYNS
Uniprot No.

Target Background

Function
This protein plays a specific role in catalyzing the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How Do Host Factors Influence Buchnera Population Size and Gene Expression?

Host factors significantly influence both Buchnera population size and gene expression patterns, which would affect lspA expression and function. Genetic variation among aphid clones results in significant differences in Buchnera titer, measured as Buchnera genomes per aphid genome . Research shows that the host genotype, rather than the symbiont genotype, appears responsible for variation in Buchnera titer .

Several key host factors affect Buchnera populations:

  • Host developmental stage: Buchnera numbers increase during juvenile stages and typically decline after the aphid reaches adulthood

  • Bacteriocyte number: The quantity of specialized cells housing Buchnera is one factor controlling symbiont titer

  • Host plant: Aphids reared on different host plants show significant variation in Buchnera densities

  • Secondary metabolites: Plant compounds like gossypol from cotton suppress Buchnera populations, while cucurbitacin from cucurbit plants increases densities

Host FactorEffect on Buchnera TiterExperimental Evidence
Host genotypeSignificant variation in titer among clones (35-73.4 Buchnera genomes per aphid genome)ANCOVA analysis shows significant differences (F₉,₉₅ = 3.21, p = 0.0019)
Host plantHigher titers in aphids reared on cucumber vs. cottonQuantitative PCR measurements across generations
Plant metabolitesGossypol (cotton) suppresses populations; cucurbitacin increases densitiesArtificial diet supplementation experiments
Host ageIncreased titer during juvenile stages, decreased in adultsTiter measurements across developmental stages

When designing experiments to study lspA expression, researchers should control for these factors to ensure reproducible results.

What Methods Are Most Effective for Quantifying Buchnera in S. graminum?

Quantitative PCR (qPCR) represents the gold standard for measuring Buchnera densities in aphids. This technique allows precise quantification of Buchnera genomes relative to host genomes, providing an accurate measure of symbiont titer.

Methodological approach for effective quantification:

  • Sample preparation:

    • Flash-freeze individual aphids in liquid nitrogen

    • Extract total DNA using phenol-chloroform extraction or commercial kits optimized for bacterial DNA

    • Control for age and developmental stage of aphids

  • qPCR optimization:

    • Target single-copy genes in both Buchnera and aphid genomes

    • Common Buchnera targets include bioA (biotin synthesis) or dnaK (heat shock protein)

    • Common aphid targets include ef1α (elongation factor) or rpl7 (ribosomal protein)

  • Data analysis:

    • Calculate the ratio of Buchnera to aphid gene copy numbers

    • Apply appropriate statistical tests (ANCOVA or ANOVA) to compare titers across experimental conditions

    • Account for variation in gene copy number between samples

Research indicates that variation in ef1α copy number explains approximately 4.4% of the variance in Buchnera titer, while bioA copy number explains 36.6% of the variance . When designing experiments, researchers should consider these sources of variation and select appropriate reference genes.

How Does Experimental Design Impact Research on Buchnera Gene Function?

When investigating gene function in obligate symbionts like Buchnera, experimental design critically impacts outcomes and interpretation. Since genetic manipulation of Buchnera remains challenging due to its obligate intracellular lifestyle, researchers must carefully consider design choices.

Three main experimental designs can be applied to Buchnera research, each with distinct advantages and limitations:

  • Repeated Measures Design:

    • Involves tracking the same aphid clones across different conditions

    • Strengths: Controls for host genetic variation, requires fewer specimens

    • Weaknesses: Potential for order effects, complete data loss if specimens die

    • Application: Ideal for studying developmental changes in lspA expression within clonal lines

  • Independent Groups Design:

    • Uses different aphid populations for each experimental condition

    • Strengths: Eliminates order effects, allows simultaneous testing

    • Weaknesses: Requires more specimens, host genetic variation may confound results

    • Application: Suitable for comparing lspA function across different Buchnera strains

  • Matched Pairs Design:

    • Matches aphids based on specific characteristics before assigning to conditions

    • Strengths: Reduces impact of host variables while testing different conditions

    • Application: Useful for comparing lspA expression in related aphid clones with different feeding behaviors

When studying genes like lspA in Buchnera, researchers should also consider:

  • Using aphid lines maintained on consistent host plants for multiple generations to stabilize Buchnera populations

  • Waiting until the third generation after host plant transfer before collecting data, as Buchnera titers fluctuate markedly in the first two generations

  • Implementing appropriate controls for host plant metabolites that might affect Buchnera physiology

What Techniques Allow Functional Analysis of Buchnera Genes Without Direct Genetic Manipulation?

Due to the obligate intracellular nature of Buchnera and its inability to be cultured outside the host, direct genetic manipulation presents significant challenges. Researchers have developed alternative approaches to study gene function:

  • Heterologous expression systems:

    • Express Buchnera lspA in model bacteria like E. coli

    • Complement lspA-deficient mutants to assess functional conservation

    • Study protein activity in controlled laboratory conditions

  • RNA interference (RNAi):

    • Inject dsRNA targeting aphid genes that interact with Buchnera

    • Observe indirect effects on symbiont function and fitness

    • Monitor changes in lspA expression in response to disrupted host pathways

  • Metabolite supplementation:

    • Supplement artificial diets with compounds that interact with lspA products

    • Measure changes in Buchnera titer and aphid fitness

    • Similar to studies showing plant metabolite effects on Buchnera populations

  • Comparative genomics and transcriptomics:

    • Compare lspA sequence and expression across different Buchnera strains

    • Correlate genetic differences with functional outcomes

    • Identify conserved domains essential for function

  • Proteomic approaches:

    • Isolate bacteriocytes to analyze Buchnera membrane proteins

    • Use mass spectrometry to identify processed lipoproteins

    • Compare proteomes between different host plant conditions

These techniques provide valuable insights despite the limitations of working with an unculturable symbiont.

How Can Researchers Address Contradictory Data When Studying Signal Peptidases in Buchnera?

When investigating specialized genes like lspA in Buchnera, researchers may encounter contradictory data due to the complex interplay between host, symbiont, and environment. A systematic approach helps resolve such contradictions:

  • Thorough data examination:

    • Identify specific discrepancies between expected and observed results

    • Examine outliers that may influence findings

    • Conduct comprehensive analysis comparing results with existing literature

  • Evaluate initial assumptions:

    • Reassess the underlying hypotheses about lspA function

    • Consider that Buchnera's reduced genome may result in moonlighting functions for proteins like signal peptidases

    • Review phylogenetic relationships between the studied strains

  • Consider alternative explanations:

    • Host plant effects: Different plant metabolites significantly impact Buchnera physiology

    • Host genotype influence: Aphid genetic background affects symbiont titer

    • Environmental factors: Temperature and other stressors affect symbiont function

  • Implement additional controls:

    • Test multiple Buchnera strains from different aphid hosts

    • Control for aphid age and developmental stage

    • Stabilize experimental populations for multiple generations

  • Refine experimental approach:

    • Modify detection methods if sensitivity issues arise

    • Implement more precise quantification techniques

    • Consider time-course experiments to capture dynamic changes

This methodical approach aligns with best practices for handling contradictory data in scientific research .

What Is Known About the Relationship Between Buchnera Membrane Proteins and Host Plant Adaptation?

The relationship between Buchnera membrane proteins (including those processed by lspA) and host plant adaptation represents a frontier in symbiosis research. Current evidence suggests significant connections:

Buchnera relies on a limited set of transporters with reduced substrate specificity compared to free-living bacteria . This streamlined membrane protein profile makes the proper processing of remaining lipoproteins by lspA potentially crucial for maintaining symbiotic function across different host plant environments.

Research demonstrates that:

  • Host plant species significantly influences Buchnera population size

  • Plant secondary metabolites directly affect Buchnera titers

  • Adaptation to new host plants requires several generations for Buchnera populations to stabilize

  • Optimal Buchnera titer appears linked to host fitness

Host PlantEffect on BuchneraPotential Membrane Protein Implications
CucumberIncreased titerPossible upregulation of nutrient transporters
CottonDecreased titerPotential expression of detoxification-related membrane proteins
Wild hosts (hibiscus, zucchini)Higher titers than cultivated hostsSuggests differential membrane protein activity in wild vs. cultivated environments

When studying lspA function in B. aphidicola from S. graminum, researchers should consider how host plant switches affect membrane protein processing demands and how this relates to the observed titer changes across different plant hosts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.