Recombinant Buchnera aphidicola subsp. Schizaphis graminum Multidrug resistance-like ATP-binding protein MdlB (mdlB)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant MdlB

Recombinant MdlB is produced for research applications, with the following key features:

PropertyDetails
Product CodeCSB-CF815699BXE
Host SpeciesBuchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Protein TypeMultidrug resistance-like ATP-binding transmembrane protein
Storage Conditions-20°C for short-term; -80°C for long-term storage
Sequence FeaturesContains conserved ATP-binding domains critical for transport activity

The recombinant protein retains structural and functional similarities to native MdlB, enabling studies on its role in bacterial physiology and aphid symbiosis .

Genomic Context of mdlB in Buchnera

The mdlB gene is part of the ATP-binding cassette (ABC) transporter family. Comparative genomic analyses reveal its evolutionary trajectory across Buchnera strains :

Table 1: Genomic Distribution of mdlB in Buchnera Lineages

Buchnera StrainGenome Size (bp)Presence of mdlBFunctional Status
BAp (A. pisum)652,115PresentFunctional
BSg (S. graminum)653,001PresentFunctional
BBp (B. pistaciae)618,379PresentPseudogenized
BCc (C. cedri)425,229AbsentLost
BCt (C. tujafilina)452,999AbsentLost

This table highlights the differential retention of mdlB, with functional copies preserved in Buchnera strains from aphids like S. graminum and A. pisum, while pseudogenized or lost in others .

Role in Multidrug Resistance

MdlB contributes to efflux mechanisms, aiding in the removal of toxic compounds. Its ATP-binding domains enable energy-dependent transport, a feature critical for bacterial survival in nutrient-limited environments .

Symbiotic Nutrient Exchange

In Buchnera from S. graminum, MdlB is implicated in amino acid transport, supporting aphid nutrition by shuttling essential metabolites like tryptophan across bacterial membranes . This aligns with Buchnera’s role in supplementing the aphid’s phloem-based diet .

Evolutionary Degeneration

Gene loss analyses show that mdlB pseudogenization in Buchnera BBp correlates with reduced transporter diversity, reflecting genomic erosion in long-term symbionts . Strains lacking mdlB (e.g., BCc) rely on co-symbionts like Serratia symbiotica for metabolic compensation .

Functional Implications of Recombinant MdlB

Recombinant MdlB serves as a tool to study:

  • Transport Mechanisms: ATP hydrolysis kinetics and substrate specificity .

  • Host-Symbiont Coevolution: How gene loss in Buchnera impacts aphid fitness .

  • Antibiotic Resistance: Parallels with multidrug efflux pumps in pathogenic bacteria .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them in your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
mdlB; BUsg_465; Multidrug resistance-like ATP-binding protein MdlB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-580
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
mdlB
Target Protein Sequence
MDHLIQFWPILKRLIIYAIPWKKKIILAFFLLLSGATSEVLGPILISYFINNILSQHQLN FQLILIIIVIFIMLQILAVFFNYFQSILFNKIAVGIVNKLRNDVMKAALNQPISEFDSQP IGQMISKVTNDTEVIKELYDTVGPTFFRSITLIIIILFAMFTLEWHMAIITIFIIPLVII VMSIYQYYSTPLLRNVRYYVANINNKFNETINGMNVIQQFRQQTRFENNIKESSELHYLA RMKILKLDGFLLRPLLSLLSALVLCSFMFLFSYFSIGVYEVGVLYAFITYLGRLNEPLIS ITIQQSILQQAIVAGERIFSLIDSPKQKYGNNEEEIKSGKINIKNLSFKYKESGENILNN INIYIPSKSFVAFVGQTGSGKSTLANLLMGYYPIKHGKIYLDDKSINCISHDVLRKNILM VQQDPIVLADTFSSNITLGKKISEEKIWNVLKTVHLSSLVQSMPKGIYSILGEEGNNLSL GQKQLLAIARILVRNPKILILDEATANIDSGTEKLIQTTLSSIRAKTTLVVIAHRLSTVI EADMIVVLKKGKIVELGTHKQLLEKKGFYWKMYNFQLFNC
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily, Drug exporter-2 (TC 3.A.1.117) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and its relationship with Schizaphis graminum?

Buchnera aphidicola is an obligate endosymbiotic bacterium that maintains a mutualistic relationship with aphids, including Schizaphis graminum (greenbug). This relationship is characterized by:

  • Obligate nature, meaning neither organism can survive without the other

  • Primary role in biosynthesis and provisioning of essential amino acids to the aphid host

  • Strong genome reduction compared to free-living bacteria

  • High A+T content in its genome

  • Differential evolutionary rates compared to free-living bacteria

Schizaphis graminum specifically is an important cereal aphid pest affecting sorghum and other crops in the United States and globally. The relationship between this aphid and its Buchnera endosymbiont has evolved over millions of years, with the bacterium residing in specialized cells called bacteriocytes .

What is the functional role of multidrug resistance-like ATP-binding protein MdlB in Buchnera aphidicola?

The multidrug resistance-like ATP-binding protein MdlB in Buchnera aphidicola belongs to the ATP-binding cassette (ABC) transporter family. Based on comparative analysis with similar proteins:

  • MdlB likely functions as a membrane transporter involved in export of various substrates

  • As an ABC transporter, it uses ATP hydrolysis as an energy source to transport substrates across membranes

  • May play a role in exporting toxic compounds from bacterial cells

  • Could potentially be involved in the transport of metabolites between the bacterium and its aphid host

  • May contribute to the symbiotic relationship by facilitating nutrient exchange

Unlike the well-characterized P-glycoprotein (Pgp) and MRP in human cells, the specific physiological substrates and detailed mechanisms of MdlB in Buchnera remain less understood, presenting opportunities for further research .

How is recombinant MdlB protein expressed and purified for research purposes?

The recombinant Buchnera aphidicola subsp. Schizaphis graminum MdlB protein is typically expressed and purified using the following methodology:

  • Expression System: The full-length protein (amino acids 1-580) is expressed in Escherichia coli with an N-terminal His-tag for purification purposes

  • Purification Process: Affinity chromatography using the His-tag

  • Final Form: The purified protein is typically provided as a lyophilized powder

  • Reconstitution Protocol:

    • Brief centrifugation before opening

    • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of glycerol (recommended final concentration 50%) for long-term storage

  • Storage Conditions: Store at -20°C/-80°C, with working aliquots at 4°C for up to one week

  • Buffer Composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

The purity of commercially available recombinant MdlB is typically greater than 90% as determined by SDS-PAGE analysis .

What experimental designs are most effective for studying MdlB function in Buchnera aphidicola?

Given the obligate nature of Buchnera and challenges in culturing this endosymbiont, several experimental approaches can be effective:

Comparative Genomics Approach:

  • Sequence analysis across multiple Buchnera strains to identify conserved domains and variations in MdlB

  • Phylogenetic analysis to trace evolutionary patterns and selective pressures

Heterologous Expression Systems:

  • Expression of MdlB in model organisms like E. coli for functional characterization

  • Use of yeast complementation assays to test function in vivo

Transport Assays:

  • Reconstitution of purified MdlB in liposomes to study transport activities

  • Fluorescent substrate accumulation assays to measure efflux activity

Structural Biology Methods:

  • X-ray crystallography or cryo-EM to determine the 3D structure

  • Molecular dynamics simulations to understand conformational changes during transport cycle

Design of Experiments (DOE) Approach:
For investigating multiple factors affecting MdlB function, a structured DOE approach is recommended. This could involve:

  • Full factorial designs to test all possible combinations of experimental factors

  • Fractional factorial designs when testing all combinations is impractical

  • Response surface designs for optimization of experimental conditions

When designing such experiments, researchers should consider using statistical tools to:

  • Minimize the number of experimental runs while maximizing information

  • Identify significant interactions between factors

  • Develop predictive models of MdlB function

  • Optimize experimental conditions for further studies

How might mutations in the mdlB gene affect the symbiotic relationship?

Mutations in the mdlB gene could potentially affect the symbiotic relationship between Buchnera aphidicola and its aphid host in several ways:

Possible Effects of mdlB Mutations:

Type of MutationPotential Impact on SymbiosisResearch Methodology
Loss-of-functionCompromised efflux of toxic metabolitesComparative metabolomics between wild-type and mutant systems
Altered substrate specificityChanged metabolite exchange patternRadioactive/fluorescent labeled substrate transport assays
Expression level changesImbalanced metabolic fluxqRT-PCR and proteomics analysis
Structural alterationsModified interaction with partner proteinsCo-immunoprecipitation and yeast two-hybrid screening

Research has shown that Buchnera has undergone genome reduction over evolutionary time, and even small losses affecting a few key genes can lead to the establishment of dual symbiotic systems, where secondary symbionts complement the functions of Buchnera . This suggests that mutations in transport proteins like MdlB could potentially trigger compensatory mechanisms, including the acquisition of secondary symbionts.

The study of such mutations would likely require:

  • Comparative genomics across aphid lineages with different symbiotic arrangements

  • Experimental systems that allow genetic manipulation of the mdlB gene

  • Metabolic flux analysis to track changes in nutrient exchange

What is the potential role of MdlB in antibiotic resistance in the Buchnera-aphid symbiosis?

As a member of the ATP-binding cassette (ABC) transporter family, MdlB shares structural similarities with multidrug resistance proteins found in other organisms. This suggests several potential roles in antibiotic resistance:

Potential Antibiotic Resistance Mechanisms:

  • Direct Efflux: MdlB may actively pump antibiotics out of Buchnera cells, reducing intracellular antibiotic concentrations

  • Protective Barrier: May prevent antibiotics from reaching their targets within the bacterial cell

  • Horizontal Gene Transfer Protection: Could limit the uptake of foreign DNA that might carry resistance genes

Research approaches to investigate this include:

  • Antibiotic susceptibility testing in systems with varying MdlB expression levels

  • Transport assays with labeled antibiotics to directly measure efflux activity

  • Comparative analysis with other ABC transporters with known antibiotic resistance functions, such as P-glycoprotein (Pgp) and MRP in human cells

The ABC transporter superfamily is involved in the transport of substrates ranging from ions to large proteins, and similar transporters in human cells (Pgp and MRP) are known to cause multidrug resistance . Understanding MdlB's role could provide insights into both evolutionary adaptations of symbiotic bacteria and potential targets for pest management strategies.

How can gene expression studies of mdlB inform understanding of symbiont-host metabolic interactions?

Gene expression studies of mdlB can provide valuable insights into symbiont-host metabolic interactions through several approaches:

Transcriptomic Analysis:

  • RNA-Seq to compare mdlB expression levels under different physiological conditions or stresses

  • Single-cell transcriptomics to understand expression variability within bacteriocyte populations

  • Time-course experiments to track expression changes during aphid development

Integrative Multi-omics Approach:
Combining multiple data types can provide a comprehensive understanding:

Data TypeInformation ProvidedIntegration Value
TranscriptomicsmdlB expression levelsBaseline activity assessment
ProteomicsMdlB protein abundance and modificationsPost-transcriptional regulation insights
MetabolomicsMetabolite profiles affected by MdlBFunctional consequences of expression changes
FluxomicsMetabolic flux through pathways involving MdlBDynamic response to environmental changes

Recent research on symbiont-host systems has revealed that dual symbioses have evolved multiple times across aphid lineages, with interdependencies between Buchnera and its partners for the production of essential nutrients . Expression studies of transport proteins like MdlB could help elucidate the metabolic pathways involved in these interdependencies.

Methodological considerations should include:

  • Appropriate controls to account for the unique genomic characteristics of Buchnera (high A+T content)

  • Validation using multiple techniques (qRT-PCR, Western blotting)

  • Careful tissue microdissection to isolate bacteriocytes where Buchnera resides

What are the challenges in working with recombinant Buchnera proteins and how can they be addressed?

Working with recombinant Buchnera proteins presents several unique challenges:

Common Challenges and Solutions:

ChallengeCauseMethodological Solution
Low expression yieldsHigh A+T content affecting codon usage in E. coliCodon optimization of gene sequence; use of specialized expression strains
Protein insolubilityMembrane protein characteristics of MdlBDetergent screening; fusion with solubility-enhancing tags; inclusion body refolding protocols
Functional verificationDifficulty in establishing relevant assaysUse of indirect assays (e.g., ATP hydrolysis); reconstitution in artificial membrane systems
Structural instabilityInherent flexibility of ABC transportersAddition of stabilizing ligands; protein engineering to reduce flexibility
Post-translational modificationsDifferences between Buchnera and expression hostMass spectrometry to identify modifications; homology modeling to predict impact

The recombinant full-length MdlB protein available commercially includes specific handling recommendations to address stability issues:

  • Avoidance of repeated freeze-thaw cycles

  • Addition of glycerol (recommended 50%) for long-term storage

  • Working aliquots should be stored at 4°C for no more than one week

How can comparative genomics approaches inform our understanding of MdlB evolution?

Comparative genomics offers powerful approaches to understand the evolution of mdlB across different Buchnera strains and related endosymbionts:

Key Comparative Genomics Methodologies:

  • Phylogenetic Analysis:

    • Construction of phylogenetic trees based on mdlB sequences from various Buchnera strains

    • Comparison with trees based on other genes to identify potential horizontal gene transfer events

    • Analysis of selection pressures using dN/dS ratios

  • Synteny Analysis:

    • Examination of gene order and conservation around the mdlB locus

    • Identification of conserved operons or regulatory elements

  • Structural Genomics:

    • Prediction of protein structural changes across evolutionary history

    • Identification of conserved functional domains versus variable regions

Research has shown that Buchnera genomes have undergone significant reduction compared to free-living bacteria, with increased A+T content and differential evolutionary rates . These evolutionary patterns likely affect transporters like MdlB, potentially impacting substrate specificity and function.

A particularly interesting aspect to investigate would be the comparison between Buchnera strains from aphid lineages with single symbiont systems versus those with dual obligate symbionts, as these may reveal adaptation patterns in transport proteins like MdlB to complement or compensate for metabolic interdependencies .

What techniques can be used to study the interaction between MdlB and other proteins in Buchnera?

Despite the challenges of working with an unculturable endosymbiont like Buchnera, several techniques can be applied to study MdlB protein interactions:

Protein Interaction Analysis Techniques:

  • Co-Immunoprecipitation (Co-IP):

    • Using antibodies against MdlB to pull down interaction partners

    • Mass spectrometry identification of co-precipitated proteins

    • Challenges include obtaining sufficient material from bacteriocytes

  • Bacterial Two-Hybrid Systems:

    • Heterologous expression of MdlB fragments in model bacteria

    • Screening for interacting partners from Buchnera genomic libraries

    • Validation of interactions in physiologically relevant contexts

  • Structural Biology Approaches:

    • Cryo-electron microscopy of purified MdlB complexes

    • Cross-linking followed by mass spectrometry (XL-MS) to identify proximity relationships

    • In silico docking studies based on predicted structures

  • Fluorescence-Based Methods:

    • Fluorescence resonance energy transfer (FRET) to study interactions in reconstituted systems

    • Split-GFP complementation assays for validation in heterologous hosts

The study of Buchnera protein interactions is complicated by the symbiotic nature of the bacterium, which has led to significant genome reduction and metabolic interdependency with its host . This makes it particularly important to consider the entire symbiotic system when interpreting protein interaction data.

How might knowledge of MdlB structure and function contribute to pest management strategies?

Understanding the structure and function of MdlB could potentially inform novel pest management strategies targeting Schizaphis graminum and related aphid pests:

Potential Applications in Pest Management:

  • Targeted Inhibitor Development:

    • Design of small molecules that specifically inhibit MdlB function

    • Disruption of essential metabolite transport between symbiont and host

    • Screening approach using recombinant MdlB in ATP hydrolysis assays

  • Symbiosis-Based Control Strategies:

    • Development of compounds that disrupt the symbiotic relationship

    • Exploitation of metabolic dependencies between aphid and Buchnera

    • Less likely to affect beneficial insects with different symbiotic arrangements

  • Integration with Host-Plant Resistance:

    • Combination with plant resistance genes like SgR1, which has been identified as conferring resistance to Schizaphis graminum in sorghum

    • SgR1 encodes a leucine-rich repeat containing receptor-like protein (LRR-RLP) that provides resistance to greenbug biotype I

    • Synergistic approaches targeting both the aphid and its essential symbiont

The recent isolation and characterization of the SgR1 gene from sorghum demonstrates progress in understanding plant resistance to Schizaphis graminum . Combining this knowledge with insights into the aphid's dependence on its Buchnera endosymbiont could lead to more effective and sustainable pest management strategies.

What are the most promising avenues for future research on MdlB?

Based on current knowledge and technological capabilities, several promising research directions for MdlB include:

  • Structural Characterization:

    • High-resolution structures using cryo-EM or X-ray crystallography

    • Investigation of conformational changes during transport cycle

  • Substrate Identification:

    • Comprehensive screening to identify physiological substrates

    • Metabolomics approaches to detect accumulated compounds in systems with impaired MdlB function

  • Systems Biology Integration:

    • Placement of MdlB function within whole-cell models of Buchnera metabolism

    • Integration with aphid host metabolic networks to understand systemic effects

  • Comparative Biology:

    • Functional comparison with ABC transporters from free-living bacteria

    • Investigation of similar transporters in other insect-microbe symbioses

  • Genetic Manipulation Approaches:

    • Development of genetic tools for manipulating gene expression in Buchnera

    • CRISPR-based approaches for targeted modifications

Recent advances in understanding the evolution of dual symbioses across aphid lineages and the cloning of aphid resistance genes in host plants provide complementary knowledge that could be integrated with MdlB research to develop a more comprehensive understanding of this complex biological system.

How can design of experiments (DOE) approaches optimize MdlB functional studies?

Design of experiments (DOE) approaches can significantly enhance the efficiency and informativeness of MdlB functional studies:

DOE Strategies for MdlB Research:

  • Screening Designs:

    • Fractional factorial designs to efficiently screen multiple factors affecting MdlB expression and function

    • Plackett-Burman designs to identify the most significant factors with minimal experimental runs

  • Optimization Designs:

    • Response surface methodology (RSM) to optimize buffer conditions for MdlB stability and activity

    • Central composite designs to identify optimal expression conditions in heterologous systems

  • Mixture Designs:

    • Simplex-lattice designs for optimizing complex media compositions for expression systems

    • Extreme vertices designs for constraints on component proportions

  • Statistical Analysis Tools:

    • ANOVA to determine significant factors and interactions

    • Regression modeling to predict optimal conditions

    • Contour plotting to visualize response surfaces

The MATLAB Statistics and Machine Learning Toolbox offers several functions specifically designed for DOE approaches that could be valuable for MdlB research, including fractional factorial designs (fracfact), candidate set generation (candgen), and D-optimal designs (cordexch) .

By implementing structured DOE approaches, researchers can:

  • Minimize the number of experiments required

  • Maximize information obtained from each experiment

  • Systematically explore the multidimensional parameter space affecting MdlB function

  • Develop predictive models to guide future experiments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.