Recombinant Buchnera aphidicola subsp. Schizaphis graminum NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nuoA; BUsg_147; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
nuoA
Target Protein Sequence
MLKNTLDMTEYLSFLYFIFFSLFFCCFMLFTSWFLGGRSLSRYKNTPFESGVVSVGNTHL HFSVKFYLIAIFFVIFDVEALYLYAWSVSIVESGWIGFVEATIFILFLLLSLFYLVRIKA LNWVTS
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled with proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and why is it significant for research involving nuoA?

Buchnera aphidicola is an intracellular bacterial endosymbiont of aphids that maintains a small genome of only about 600 kbps. It has evolved as an obligate symbiont, providing essential amino acids that are limiting in the aphid's diet . The relationship between Buchnera and aphids represents a model system for studying host-symbiont coevolution. nuoA, as part of the NADH-quinone oxidoreductase complex (Complex I), plays a critical role in the endosymbiont's energy metabolism despite extensive genome reduction, making it particularly interesting for understanding essential gene retention in symbiotic bacteria .

What is the evolutionary significance of nuoA retention in Buchnera genomes?

The retention of nuoA in the highly reduced Buchnera genome indicates its essential role in cellular energetics. Despite significant genome reduction across Buchnera lineages, genes encoding respiratory chain components like nuoA have been maintained . This retention suggests strong selective pressure to preserve energy generation mechanisms even as many other metabolic pathways have been lost. Comparative genomic studies across Buchnera from different aphid hosts show that while substantial gene loss has occurred in each lineage, core metabolic functions including energy production remain conserved . The preservation of nuoA and other respiratory complex components demonstrates their critical importance for symbiont survival and function.

How does the structure of nuoA in Buchnera differ from that in free-living bacteria?

The nuoA protein in Buchnera aphidicola maintains its core structural features despite sequence divergence from free-living relatives. In Buchnera aphidicola subsp. Baizongia pistaciae, the nuoA protein consists of 132 amino acids forming multiple transmembrane domains . This is notably longer than the 120 amino acid sequence found in some free-living bacteria like Moorella thermoacetica . The Buchnera nuoA protein sequence (MLKSSVIAAQYWAFFTFFFIAVSICVFMLSISWILGGRSSSRYKNTPFESGIVPTNTTNMYCSVKFYLVAIYFVLFDVEALYLYAWSVSIVECGWIGFIEALIFILFLLSGLIYLISSKLLVWKSKNNIHVT) shows characteristic membrane-spanning hydrophobic regions essential for its function in the respiratory chain . While sequence divergence is evident, functional constraints have preserved the core structural elements necessary for electron transport and membrane integration.

How do genetic bottlenecks affect nuoA sequence evolution in Buchnera populations?

Genetic bottlenecks during maternal transmission significantly influence nuoA sequence evolution in Buchnera populations. Research on natural populations of aphids has revealed remarkably low sequence diversity in Buchnera genes, with polymorphism approximately three orders of magnitude lower than in enteric bacteria . This genetic homogeneity extends to respiratory chain genes like nuoA. Analysis of polymorphism patterns reveals an excess of nonsynonymous mutations and rare alleles in Buchnera populations , consistent with reduced efficacy of purifying selection under genetic drift conditions. These bottlenecking effects explain the accelerated evolutionary rates observed in nuoA and other Buchnera genes, without necessarily indicating relaxed functional constraints. The patterns suggest that population structure and transmission dynamics substantially influence nuoA sequence evolution while maintaining its essential function.

What methodological approaches are most effective for comparative analysis of nuoA across different Buchnera strains?

For comparative analysis of nuoA across Buchnera strains, researchers should implement a multi-faceted approach:

MethodApplicationKey Considerations
Genome skimmingInitial acquisition of nuoA sequencesSuccessful for obtaining complete Buchnera genomes from aphid samples
Phylogenomic analysisEvolutionary relationship reconstructionShould include multiple loci beyond nuoA for context
Selection analysisIdentification of selection pressuresdN/dS calculations with appropriate neutral models
Protein structure predictionFunctional conservation assessmentAccounts for sequence divergence while revealing conserved domains
Transcriptomic analysisExpression pattern comparisonReveals potential regulatory differences between strains

The most successful approaches integrate genomic data with functional characterization. For example, researchers studying Rhus gall aphids assembled complete Buchnera genomes from 16 aphid samples representing 13 species across six genera using shotgun genome skimming methods . This approach enabled comprehensive comparative analysis revealing evolutionary patterns while maintaining functional context. When analyzing nuoA specifically, researchers should consider both sequence-level changes and the broader genomic context of the nuo operon structure.

How does recombinant nuoA expression compare between different expression systems?

Expression of recombinant Buchnera nuoA presents distinct challenges across different expression systems:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coliSuccessfully demonstrated for Buchnera proteins Codon usage differencesRequires optimization for membrane proteins
Yeast systemsBetter for eukaryotic post-translational modificationsMore complex media requirementsAlternative for difficult-to-express variants
Cell-free systemsAvoids toxicity issuesLower yieldsUseful for initial characterization
Specialized E. coli strainsEnhanced membrane protein expressionHigher costRecommended for structural studies

E. coli expression systems have been successfully employed for both Buchnera aphidicola subsp. Baizongia pistaciae nuoA and similar proteins from other bacteria . The expression constructs typically include N-terminal His-tags to facilitate purification. For optimal expression, codon optimization for E. coli is recommended given the AT-rich nature of the Buchnera genome. Temperature reduction during induction (to 16-25°C) often improves folding of membrane proteins like nuoA. The choice of expression system should be guided by the specific experimental goals, with E. coli systems generally providing the best balance of yield and authenticity for Buchnera proteins.

What purification strategies yield the highest purity for recombinant Buchnera nuoA protein?

Achieving high-purity recombinant Buchnera nuoA protein requires a strategic multi-step purification approach:

  • Initial Extraction: For membrane proteins like nuoA, effective solubilization requires careful detergent selection. Mild non-ionic detergents (DDM, LMNG) at concentrations just above their critical micelle concentration typically provide optimal extraction from E. coli membranes.

  • Affinity Chromatography: His-tagged nuoA constructs can be efficiently purified using Ni-NTA resin . The protocol should include:

    • Binding in buffer containing appropriate detergent

    • Extensive washing with increasing imidazole concentrations (10-40 mM)

    • Elution with higher imidazole (250-500 mM)

  • Secondary Purification: Size exclusion chromatography effectively removes aggregates and improves purity beyond 90%, the standard achieved in commercial preparations .

  • Quality Control: SDS-PAGE analysis, mass spectrometry verification, and functional assays should confirm protein identity and integrity.

For optimal results, all buffers should contain stabilizing agents such as glycerol (5-10%) and appropriate detergent concentrations throughout purification. Following these approaches, researchers have successfully purified Buchnera membrane proteins to greater than 90% purity as determined by SDS-PAGE .

How can researchers overcome challenges in expressing Buchnera membrane proteins like nuoA?

Expressing Buchnera membrane proteins presents several challenges that researchers can address through specific strategies:

  • Codon Optimization: Buchnera's AT-rich genome creates suboptimal codon usage for E. coli expression. Custom gene synthesis with codon optimization improves expression levels dramatically.

  • Expression Vector Selection: Vectors containing tightly regulated promoters (T7) with appropriate signal sequences improve targeting to bacterial membranes. N-terminal His-tagging has proven successful for Buchnera nuoA proteins .

  • Cell Strain Selection: C41(DE3) or C43(DE3) E. coli strains, specifically developed for membrane protein expression, often yield better results than standard BL21 strains.

  • Induction Protocol Optimization:

    • Lower temperatures (16-20°C)

    • Reduced IPTG concentrations (0.1-0.5 mM)

    • Extended expression times (overnight)

    • Addition of membrane-stabilizing compounds like specific lipids

  • Fusion Tag Approaches: For particularly challenging constructs, fusion with solubility-enhancing tags (MBP, SUMO) can improve expression.

These techniques have successfully produced functional nuoA and similar proteins from Buchnera and other bacteria in E. coli expression systems , yielding sufficient material for structural and functional studies.

What are the optimal storage conditions for maintaining stability of purified recombinant nuoA?

Maintaining stability of purified recombinant nuoA requires careful attention to storage conditions:

  • Immediate Post-Purification Handling:

    • Concentration determination using Bradford or BCA assays

    • Addition of stabilizing agents (glycerol, specific lipids if needed)

    • Aliquoting to minimize freeze-thaw cycles

  • Short-Term Storage (up to one week):

    • 4°C storage is suitable for working aliquots

    • Maintain appropriate detergent concentrations above CMC

    • Include protease inhibitors to prevent degradation

  • Long-Term Storage Options:

    • Flash freezing in liquid nitrogen followed by -80°C storage

    • Lyophilization with cryoprotectants (6% trehalose recommended)

    • For lyophilized preparations, storage at -20°C/-80°C is appropriate

  • Reconstitution Protocol (for lyophilized protein):

    • Brief centrifugation before opening to collect material

    • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of glycerol (recommended final concentration 50%) for freeze stability

  • Stability Monitoring:

    • Periodic SDS-PAGE analysis to assess integrity

    • Functional assays where applicable

    • Size exclusion chromatography to detect aggregation

Adhering to these guidelines has been demonstrated to maintain protein stability and functionality for both Buchnera proteins and similar membrane proteins from other bacterial species .

What analytical techniques are most informative for structural characterization of recombinant nuoA?

Structural characterization of recombinant nuoA requires complementary analytical approaches that address different aspects of protein structure:

  • Secondary Structure Analysis:

    • Circular Dichroism (CD) spectroscopy provides information on α-helical content, critical for transmembrane domains in nuoA

    • Fourier Transform Infrared Spectroscopy (FTIR) offers complementary data on secondary structure elements

  • Membrane Protein-Specific Approaches:

    • Detergent micelle or nanodisc reconstitution for solution-based studies

    • Lipid cubic phase crystallization for structural determination attempts

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • High-Resolution Structural Analysis:

    • Cryo-electron microscopy as part of the entire Complex I assembly

    • X-ray crystallography for atomic resolution (challenging for membrane proteins)

    • Nuclear Magnetic Resonance (NMR) for specific domains or with isotopic labeling

  • Functional Context:

    • Native mass spectrometry to assess oligomeric state and complex formation

    • Cross-linking mass spectrometry to identify interaction interfaces with other complex components

    • Fluorescence-based assays for conformational changes during function

  • Computational Integration:

    • Molecular dynamics simulations in membrane environments

    • Homology modeling based on structures of nuoA from related organisms

Implementation of these techniques allows researchers to build a comprehensive structural model of nuoA in relation to its function within the NADH-quinone oxidoreductase complex. The extraction of membrane protein complexes, as demonstrated for Buchnera flagellar basal bodies , provides a methodological framework applicable to nuoA-containing complexes.

How can nuoA be used as a phylogenetic marker for studying Buchnera evolution?

The nuoA gene serves as a valuable phylogenetic marker for studying Buchnera evolution due to several key properties:

  • Universal Presence: Unlike many Buchnera genes that may be lost in various lineages, nuoA is part of the core genome containing 256 genes conserved across different Buchnera strains , making it consistently available for comparison.

  • Evolutionary Rate: nuoA exhibits an evolutionary rate that provides sufficient variation for resolving relationships between Buchnera from different aphid hosts while maintaining alignable sequence homology.

  • Coevolutionary Signal: When analyzed alongside other genes, nuoA contributes to the strong phylogenetic signal that demonstrates significant coevolution between Buchnera and their aphid hosts at individual, species, generic, and tribal levels .

  • Methodological Approach:

    • PCR amplification with conserved primers

    • Inclusion in multi-gene phylogenetic analyses

    • Comparison with host mitochondrial and nuclear genes for cophylogenetic analysis

Researchers successfully reconstructed Buchnera phylogeny using 72 complete genomes, demonstrating significant coevolution with host aphids . When using nuoA as a phylogenetic marker, researchers should consider its position within a larger genomic context, as Buchnera genomes show remarkable stability in gene order despite sequence divergence .

What functional assays can assess the activity of recombinant nuoA in vitro?

Assessing recombinant nuoA activity presents unique challenges due to its function as part of the larger NADH-quinone oxidoreductase complex. The following approaches can provide insights into nuoA functionality:

  • Complex I Reconstitution Assays:

    • Co-expression with other Complex I components

    • Measurement of NADH oxidation rates using standard spectrophotometric methods

    • Coupling to artificial electron acceptors like ferricyanide

  • Membrane Integration Assessment:

    • Liposome incorporation efficiency

    • Proteoliposome-based proton pumping assays using pH-sensitive fluorescent dyes

    • Membrane potential measurements with voltage-sensitive dyes

  • Interaction Analyses:

    • Pull-down assays with other Complex I subunits

    • Surface plasmon resonance for quantifying binding affinities

    • Crosslinking coupled with mass spectrometry to identify interaction interfaces

  • Structural Integrity Assessments:

    • Thermostability assays using differential scanning fluorimetry

    • Limited proteolysis to assess proper folding

    • Native gel electrophoresis to evaluate complex formation

These functional assays should be conducted under conditions that approximate the physiological environment of Buchnera, including appropriate pH, ion concentrations, and membrane composition. While complete reconstitution of functional Complex I is challenging, these approaches provide valuable insights into nuoA's contribution to the complex's structure and function.

How does the nuoA protein from Buchnera contribute to understanding minimal energy generation systems?

The nuoA protein from Buchnera provides critical insights into minimal energy generation systems through several key aspects:

  • Evolutionary Conservation: Despite extensive genome reduction in Buchnera (to approximately 600 kbps) , nuoA and other respiratory chain components are retained, indicating their essential nature for cellular energetics even in a minimal system.

  • Structural Minimalism: Analysis of Buchnera nuoA reveals what structural elements are absolutely essential for function versus those that can be modified or lost. The 132-amino acid sequence in Buchnera aphidicola subsp. Baizongia pistaciae maintains core functional domains while showing evolutionary streamlining .

  • Comparative Framework:

    • Comparing nuoA sequences across Buchnera strains reveals which residues are invariant (likely essential) versus those showing variability

    • The pan-genome of Buchnera containing 684 genes, with a core genome of 256 genes , provides context for understanding essential energy generation components

  • Systems Perspective: The retention of the complete nuo operon in Buchnera demonstrates that energy generation through oxidative phosphorylation remains essential even when many other metabolic pathways have been lost.

  • Biotechnological Applications: Understanding the minimal requirements for functional respiratory complexes through analysis of Buchnera nuoA can inform synthetic biology approaches for designing minimal energy generation systems.

The Buchnera system thus serves as a natural experiment in genome minimization while maintaining essential energy generation functions, providing unique insights impossible to obtain from free-living organisms with more complex genomes.

What technical advances would most benefit research on Buchnera nuoA and related proteins?

Several technical advances would significantly enhance research on Buchnera nuoA and related proteins:

  • Improved Membrane Protein Expression Platforms:

    • Development of specialized expression vectors optimized for AT-rich endosymbiont genes

    • Cell-free systems specifically designed for membrane protein production

    • Advanced detergent and nanodisk technologies for improved stability

  • In situ Structural Characterization:

    • Cryo-electron tomography methods for visualizing protein complexes within intact Buchnera cells

    • Advanced labeling techniques for super-resolution microscopy of protein complexes in their native environment

    • Correlative light and electron microscopy approaches for targeted analysis

  • Functional Assay Development:

    • High-sensitivity assays for measuring electron transport in minimal systems

    • Miniaturized platforms for rapid screening of conditions affecting nuoA structure and function

    • Real-time measurement of proton translocation in reconstituted systems

  • Computational Approaches:

    • Improved algorithms for modeling membrane protein evolution under genetic drift

    • Machine learning approaches for predicting functional impacts of sequence variations

    • Systems biology models integrating genomic, structural, and functional data

  • Genetic Manipulation:

    • Development of genetic tools for manipulating Buchnera within aphids

    • CRISPR-based approaches for targeted mutagenesis of nuoA and related genes

    • Complementation systems for functional testing of variants

These technical advances would enable researchers to move beyond descriptive studies to mechanistic understanding of how nuoA functions within the unique context of an obligate endosymbiont .

How might research on Buchnera nuoA inform synthetic biology approaches for minimal cellular systems?

Research on Buchnera nuoA provides valuable insights for synthetic biology approaches to minimal cellular systems:

  • Essential Component Identification: The retention of nuoA in the highly reduced Buchnera genome (approximately 600 kbps) identifies it as an essential component for even minimalist cellular systems, informing the design of minimal synthetic cells.

  • Modular Energy Systems: Understanding the minimal functional unit of Complex I through nuoA research allows synthetic biologists to design streamlined energy generation modules for artificial cells.

  • Sequence-Function Relationships: The natural variation in nuoA across Buchnera strains reveals which sequence elements can be modified without loss of function, providing design principles for synthetic proteins.

  • Coevolutionary Design Principles: The coevolutionary patterns observed between Buchnera and aphids demonstrate how component parts must evolve in coordination, informing synthetic biology approaches that require integrated system design.

  • Membrane Interface Engineering: The structure and function of membrane proteins like nuoA provide templates for designing synthetic membrane interfaces in artificial cells.

  • Efficiency Parameters: The energy generation system in Buchnera represents a naturally optimized minimal system, providing benchmarks for efficiency in synthetic designs.

These insights from nuoA research contribute to the fundamental knowledge needed for bottom-up synthetic biology approaches aiming to create minimal functional cells with defined components and capabilities .

What are the major unsolved questions regarding the structure and function of nuoA in Buchnera?

Several critical questions regarding Buchnera nuoA structure and function remain unresolved:

  • Structural Adaptations: How has the structure of nuoA adapted to the intracellular environment of bacteriocytes compared to its homologs in free-living bacteria? High-resolution structural data for Buchnera nuoA is currently lacking.

  • Functional Efficiency: Does nuoA in Buchnera operate with different efficiency parameters compared to homologs in free-living bacteria? Quantitative bioenergetic measurements in the Buchnera system are technically challenging.

  • Regulatory Mechanisms: How is nuoA expression regulated in the context of the highly reduced Buchnera genome? The streamlined regulatory systems in Buchnera suggest potential novel control mechanisms.

  • Host Interactions: Does the aphid host influence nuoA function through provision of cofactors or regulatory molecules? The intimate metabolic integration between Buchnera and aphids suggests potential host factors affecting nuoA function.

  • Evolutionary Trajectory: Is nuoA continuing to evolve toward further minimization, or has it reached a functional minimum? Comparative genomics across Buchnera strains shows varying degrees of genome reduction .

  • Complex Assembly: How is the assembly of Complex I coordinated in Buchnera given its reduced chaperone systems? This question parallels uncertainties about flagellar basal body assembly in Buchnera .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.