Recombinant Buchnera aphidicola subsp. Schizaphis graminum NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

NADH-quinone oxidoreductase subunit K (nuoK) is a component of Complex I (NADH:ubiquinone oxidoreductase) in the respiratory chain, facilitating electron transfer from NADH to quinones . In Buchnera aphidicola, this enzyme supports energy metabolism critical for maintaining its symbiotic relationship with aphids, enabling the synthesis of essential amino acids for the host .

Recombinant Production

Recombinant nuoK is synthesized using heterologous expression systems to study its structure and function. Key production methods include:

Expression Systems

SystemHostTagLengthPuritySource
BaculovirusInsect cellsVariable*Partial>85%
E. coliBacterialN-terminal HisFull (1-100 aa)>90%

*Tag type (N- or C-terminal) depends on stability requirements .

Key Parameters

  • Storage: Lyophilized form stable for 12 months at -20°C/-80°C; liquid form lasts 6 months .

  • Reconstitution: Requires deionized sterile water (0.1–1.0 mg/mL) with glycerol (5–50%) to prevent aggregation .

  • Avoidance of freeze-thaw cycles: Working aliquots stored at 4°C for ≤1 week .

Sequence and Structure

  • Amino Acid Sequence: MISLFHGLFLSLILFILGLTSLIVRRNILFILISLEIMMNAVGLALIVVGSYWHQADGQI... (partial) or MISLFHGLFLSLILFILGLTSLIVRRNILFMLISLEIMMNAAALALVVSGSYWKQSDGQI... (full-length) .

  • Molecular Weight: ~12–14 kDa (predicted for partial sequences) .

Functional Domains

  • Binds FAD non-covalently for electron transfer .

  • Contains conserved motifs for quinone reduction and NADH interaction .

Comparative Genomics

  • Gene Conservation: nuoK is part of a highly conserved operon in Buchnera spp., with near-identical gene order across strains diverging 80–150 million years ago .

  • Evolutionary Stability: Despite genome reduction (e.g., Buchnera’s 618-kb genome), nuoK remains intact, underscoring its essential role .

Enzymatic Studies

  • Inhibitor Sensitivity: Competitively inhibited by dicoumarol (K<sub>i</sub> ~50 pM in homologs) .

  • Thermostability: Retains activity under aphid physiological conditions, reflecting adaptation to host thermal environments .

Implications for Symbiosis

  • Metabolic Dependency: Buchnera’s NADH-quinone oxidoreductase activity is vital for regenerating NAD<sup>+</sup>, enabling amino acid biosynthesis critical for aphid survival .

  • Genome Streamlining: Loss of redundant metabolic genes in Buchnera contrasts with retention of nuoK, highlighting its irreplaceability .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly sent with blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point for your use.
Shelf Life
The shelf life of the protein is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
nuoK; BUsg_156; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
nuoK
Target Protein Sequence
MISLFHGLFLSLILFILGLTSLIVRRNILFMLISLEIMMNAAALALVVSGSYWKQSDGQI MYILAITLAASEASIALALLLQLYRRQRTLNINALSEMSG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction with proton translocation, where for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane. This process conserves the redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of NADH-quinone oxidoreductase in Buchnera aphidicola?

NADH-quinone oxidoreductase (Complex I) represents a critical component of the respiratory chain in Buchnera aphidicola, despite its reduced genome. Evolutionary analysis suggests that respiratory components have been selectively maintained during the extensive genome reduction that occurred following the establishment of symbiosis with aphids approximately 200 million years ago . The maintenance of respiratory chain components like nuoK indicates their essential function in energy production within the symbiotic relationship. Unlike many other metabolic pathways that have been lost during reductive evolution, the retention of NADH dehydrogenase components suggests their critical role in maintaining the obligate symbiotic relationship with aphids .

What is known about gene organization of the nuo operon in Buchnera aphidicola?

The genomic organization of respiratory chain components in Buchnera aphidicola shows remarkable conservation despite extensive genome reduction. Analysis of sequenced Buchnera genomes reveals nearly perfect gene-order conservation , suggesting that the arrangement of the nuo operon was established early in the symbiotic relationship and has been maintained across different Buchnera lineages. Interestingly, some nuo genes show evidence of fusion, as demonstrated by the nuoC(D) fusion identified in previous studies . This gene fusion pattern represents an adaptation that likely maintains functional relationships between subunits while economizing on genomic content, a characteristic feature of the reductive genome evolution in this endosymbiont.

What are the optimal conditions for expressing recombinant Buchnera aphidicola nuoK in heterologous systems?

Expressing recombinant Buchnera proteins presents unique challenges due to their adaptation to the specialized intracellular environment of aphid bacteriocytes. Successful expression protocols typically involve:

ParameterRecommended ConditionsRationale
Expression SystemE. coli BL21(DE3)Phylogenetic similarity to Buchnera's Enterobacterales ancestry
Temperature16-18°CReduced aggregation of membrane proteins
Induction0.1-0.5 mM IPTGLower concentrations reduce toxicity
Buffer Composition50 mM Tris-HCl, 100 mM NaCl, pH 7.5 with 10% glycerolStabilizes membrane proteins
Detergent0.5-1% n-Dodecyl β-D-maltosideEfficient for membrane protein solubilization

Optimizing these parameters is critical as membrane proteins like nuoK often present solubility challenges. Incorporating molecular chaperones in the expression system may improve folding efficiency, addressing the inherent folding limitations observed in Buchnera proteins . For purification, a combination of affinity chromatography followed by size exclusion chromatography typically yields the best results for structural and functional studies.

What methods are most effective for analyzing protein-protein interactions between nuoK and other NADH-quinone oxidoreductase subunits?

Investigating the interaction network of nuoK with other Complex I subunits requires specialized approaches for membrane protein complexes:

  • Blue Native PAGE provides a useful first-step analysis to preserve native protein complexes and identify the integration of nuoK within the complete NADH dehydrogenase complex.

  • Crosslinking mass spectrometry (XL-MS) with membrane-permeable crosslinkers like DSS or BS3 can capture interactions between nuoK and neighboring subunits, providing spatial constraints for structural modeling.

  • Bacterial two-hybrid systems modified for membrane proteins offer an in vivo approach to confirm specific binary interactions between nuoK and other subunits.

  • FRET-based approaches using fluorescently tagged subunits can provide dynamic information about subunit associations in reconstituted membrane systems.

When designing these experiments, it's important to consider the evidence of subunit fusion observed in other nuo components (e.g., nuoC and nuoD) , which suggests tight functional coupling between certain subunits within the complex. The analysis should account for potential differences in membrane composition between Buchnera's native environment and experimental systems.

What considerations should be made when designing mutagenesis studies for nuoK in Buchnera aphidicola?

Designing meaningful mutagenesis studies for nuoK requires careful consideration of Buchnera's unique evolutionary context and the functional constraints on respiratory components:

  • Target conserved residues identified through comparative genomics across multiple Buchnera strains, focusing particularly on regions that show higher conservation than would be expected under neutral evolution.

  • Consider the reduced folding efficiency characteristic of Buchnera proteins when predicting the impact of mutations on protein stability.

  • Focus on residues at interfaces with other Complex I subunits, particularly those interacting with fused subunits like nuoC(D) , as these may reveal adapted interaction networks specific to Buchnera.

  • Develop appropriate heterologous functional assays, as direct genetic manipulation of Buchnera is challenging due to its obligate endosymbiotic lifestyle.

  • Incorporate computational predictions based on the growing database of Buchnera genomes to prioritize mutations most likely to affect function while maintaining fold stability.

When interpreting mutagenesis results, consider that the long-term genomic stasis in Buchnera suggests that even seemingly minor sequence changes may have significant functional implications that have been selected against during evolution.

How should researchers interpret evolutionary rate variations across different domains of the nuoK protein?

Evolutionary rate analysis of nuoK requires sophisticated approaches that account for Buchnera's unique evolutionary history:

Domain TypeExpected Evolutionary RateInterpretation Framework
TransmembraneSlower (more conserved)Critical for membrane integration and proton translocation
Cytoplasmic loopsVariableMay show lineage-specific adaptations
Subunit interfacesContext-dependentConservation patterns reveal functional coupling

When analyzing sequence conservation, researchers should consider:

  • The genomic stasis that characterizes Buchnera evolution after establishing symbiosis with aphids approximately 200 million years ago .

  • The potential impact of the strictly vertical transmission pattern, which limits opportunities for recombination and horizontal gene transfer .

  • The possibility of compensatory mutations that maintain function despite ongoing genome degradation .

  • The context of specific host adaptations across different aphid species, which may drive subtle variations in respiratory efficiency requirements .

Most importantly, researchers should consider that standard models of molecular evolution may not fully apply to endosymbionts like Buchnera, which experience unique selective pressures related to their obligate intracellular lifestyle and reduced effective population sizes.

What approaches should be used to distinguish functional constraints from genetic drift in nuoK sequence evolution?

Distinguishing between functional constraints and genetic drift in the evolution of Buchnera nuoK requires specialized analytical approaches:

  • Compare dN/dS ratios across different Buchnera lineages, accounting for the accelerated evolutionary rates characteristic of endosymbionts with reduced effective population sizes.

  • Implement coevolutionary analyses to identify coordinated changes between nuoK and interacting subunits, particularly focusing on interactions with fused subunits like nuoC(D) .

  • Utilize ancestral sequence reconstruction methods to identify the trajectory of sequence changes since the establishment of symbiosis.

  • Compare sequence evolution patterns against structural predictions, focusing on residues involved in proton translocation and quinone binding.

  • Incorporate information from the growing database of Buchnera genomes across different aphid hosts to identify host-specific adaptations versus universal constraints.

When interpreting these analyses, researchers should consider that Buchnera has experienced extensive genome reduction while maintaining essential functions , suggesting that remaining genes like nuoK are under strong purifying selection despite the general trend toward genome degradation.

How can comparative genomics inform our understanding of nuoK function across different Buchnera strains?

Comparative genomic analysis of nuoK across the expanding collection of sequenced Buchnera genomes provides crucial insights into functional conservation and adaptation:

  • Synteny analysis reveals the remarkable conservation of gene order in the nuo operon across Buchnera lineages, indicating strong selection against genomic rearrangements .

  • Identification of lineage-specific sequence variations, particularly in Buchnera strains from aphid hosts with different nutritional requirements or environmental adaptations.

  • Analysis of codon usage bias patterns as indicators of expression levels and translational optimization.

  • Examination of the genetic context, including potential regulatory elements and operon structure conservation.

  • Investigation of potential compensatory evolution between interacting subunits across different Buchnera lineages.

This comparative approach becomes particularly powerful as more genomes become available , allowing researchers to correlate sequence variations with specific host adaptations or ecological factors. The insights gained can guide experimental design by identifying critical residues for functional studies and suggesting hypotheses about nuoK's role in maintaining energetic homeostasis within the symbiotic system.

What are the best practices for purifying recombinant Buchnera aphidicola nuoK protein for structural studies?

Purifying membrane proteins like nuoK from Buchnera aphidicola requires specialized protocols to maintain structure and function:

Purification StepRecommended ApproachCritical Considerations
Cell LysisGentle methods (e.g., lysozyme with mild sonication)Prevent aggregation of membrane proteins
Membrane ExtractionDifferential centrifugation (40,000-100,000 × g)Separate from cytoplasmic contaminants
Solubilizationn-Dodecyl β-D-maltoside or LMNG at 1-2%Test multiple detergents for optimal stability
Affinity PurificationIMAC with extended washesUse histidine tag with TEV cleavage site
Secondary PurificationSize exclusion chromatographyAssess oligomeric state and homogeneity
Buffer Optimization50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5% glycerol, 0.03% DDMMaintain stability during concentration

For structural studies, researchers should consider:

  • Detergent screening is critical, as the optimal detergent can vary even between closely related proteins.

  • Incorporating lipids from E. coli during purification may improve stability, given Buchnera's evolutionary relationship to Enterobacterales .

  • Consider nanodiscs or amphipols for detergent-free structural studies, which may better mimic the native membrane environment.

  • For cryo-EM studies, grid optimization with specific additives may be necessary to overcome preferred orientation issues common with membrane proteins.

Given the computational prediction that Buchnera proteins have reduced folding efficiency compared to free-living bacteria , particular attention should be paid to protein stability throughout the purification process.

What approaches are most effective for studying the integration of nuoK within the complete NADH-quinone oxidoreductase complex?

Investigating the integration of nuoK within the complete NADH-quinone oxidoreductase complex requires specialized structural and functional approaches:

These approaches should account for the unique evolutionary context of Buchnera, particularly the extensive genome reduction and potential adaptations to the intracellular environment of aphid bacteriocytes.

What considerations should be made when designing activity assays for recombinant nuoK and reconstituted NADH-quinone oxidoreductase complexes?

Designing effective activity assays for recombinant nuoK and reconstituted complexes requires careful consideration of both the biochemical and evolutionary context:

  • Buffer composition and assay conditions:

    • pH should reflect the intracellular environment of bacteriocytes (typically pH 7.0-7.5).

    • Include physiologically relevant ion concentrations, particularly K+ and Mg2+.

    • Temperature range should account for the temperature sensitivity of aphids (typically 15-25°C).

  • Substrate considerations:

    • Use natural ubiquinone (UQ-8) as the electron acceptor when possible, as it represents the likely physiological substrate in Buchnera.

    • Consider the potential differences in substrate affinity between Buchnera Complex I and model systems.

  • Control experiments:

    • Include specific Complex I inhibitors (e.g., rotenone, piericidin A) to confirm that measured activity represents genuine Complex I function.

    • Compare with equivalent subunits/complexes from E. coli as a reference point, given Buchnera's evolutionary relationship to Enterobacterales .

  • Data interpretation framework:

    • Account for the potential lower catalytic efficiency expected from proteins with reduced folding efficiency .

    • Consider that optimized activity may not reach levels observed in free-living bacteria, reflecting adaptation to the stable intracellular environment.

  • Technical considerations:

    • Ensure sufficient sensitivity in detection methods, as activity may be lower than in conventional model systems.

    • Implement controls for background oxidation and non-specific activity.

By incorporating these considerations, researchers can develop physiologically relevant assays that account for the unique evolutionary and functional context of Buchnera aphidicola nuoK and its role in the endosymbiotic relationship with aphids.

How might the study of nuoK contribute to our understanding of reductive genome evolution in endosymbionts?

The study of nuoK in Buchnera aphidicola provides a valuable lens for understanding broader patterns of reductive genome evolution in endosymbionts:

  • As part of the electron transport chain, nuoK represents a component of core energy metabolism that has been retained despite extensive genome reduction to 600-650 kb , offering insights into the minimal genetic requirements for cellular energetics in obligate endosymbionts.

  • Comparative analysis of nuoK across different Buchnera strains can reveal the timeline of sequence evolution in relation to the establishment of symbiosis approximately 200 million years ago and subsequent diversification .

  • Analysis of selection pressures on nuoK can illuminate how functional constraints operate within the context of the "long-term deterioration" model of endosymbiont evolution , potentially revealing compensatory mechanisms that maintain essential functions despite genome degradation.

  • The retention of complete respiratory chain components despite loss of many biosynthetic pathways suggests prioritization of energy production over metabolic versatility, a key principle in understanding the evolution of obligate endosymbiotic relationships.

The insights gained from nuoK studies contribute to theoretical models of how bacterial genomes evolve under the unique selective pressures of intracellular lifestyles and how this relates to the remarkable longevity of the aphid-Buchnera symbiosis despite ongoing genomic degradation.

What insights can nuoK provide about the coordination between host and symbiont metabolic systems?

The study of nuoK and NADH-quinone oxidoreductase function in Buchnera provides critical insights into host-symbiont metabolic integration:

  • Energy production through oxidative phosphorylation in Buchnera must be calibrated to meet the metabolic demands of both the symbiont and its contribution to host nutrition, particularly amino acid biosynthesis .

  • The retention of respiratory chain components despite genome reduction suggests that symbiont-generated ATP may play a role in energizing biosynthetic pathways critical for the host, creating selective pressure for efficient respiratory function.

  • Potential regulatory adaptations in nuoK and other respiratory components may reveal mechanisms of metabolic coordination between host and symbiont, particularly in response to varying nutritional states of the aphid host.

  • Comparative analysis across different Buchnera strains from aphids with different feeding habits may reveal adaptations in respiratory efficiency related to specific host nutritional requirements .

This research direction connects the molecular details of nuoK function to the broader ecological context of the aphid-Buchnera symbiosis, potentially revealing general principles about energy metabolism coordination in endosymbiotic relationships that have significant implications for understanding the evolution of mitochondria and other organelles.

How can systems biology approaches integrate nuoK function into models of Buchnera metabolism?

Integrating nuoK function into systems biology models of Buchnera metabolism requires sophisticated computational approaches that account for the unique constraints of this endosymbiotic system:

  • Flux balance analysis (FBA) modeling:

    • Incorporate realistic constraints on ATP production based on experimental measurements of respiratory chain activity.

    • Model the energetic requirements of amino acid biosynthesis pathways that constitute Buchnera's primary contribution to host nutrition .

    • Account for the metabolite exchange between host and symbiont in determining optimal flux distributions.

  • Multi-omics data integration:

    • Correlate nuoK expression levels with metabolomic profiles to identify relationships between respiratory activity and metabolic outputs.

    • Integrate proteomic data on Complex I subunit stoichiometry to refine models of energy production capacity.

    • Incorporate transcriptomic data across different developmental stages of the aphid host to identify potential regulatory patterns.

  • Agent-based modeling:

    • Develop spatially explicit models of bacteriocytes that account for the clustering of thousands of Buchnera cells within specialized host cells .

    • Model the impact of local environmental factors (pH, metabolite concentrations) on respiratory chain function.

  • Comparative systems approaches:

    • Leverage the growing database of Buchnera genomes to identify system-level adaptations in energy metabolism across different host-symbiont pairs.

    • Compare with related free-living bacteria to identify symbiosis-specific network features.

These integrated approaches can reveal how nuoK and oxidative phosphorylation are embedded within the larger metabolic network of Buchnera, providing insights into how this minimal system maintains functionality despite extensive genome reduction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.