Recombinant Buchnera aphidicola subsp. Schizaphis graminum Preprotein translocase subunit SecE (secE)

Shipped with Ice Packs
In Stock

Description

Introduction and Definition

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Preprotein translocase subunit SecE (secE) is a recombinant protein derived from the obligate endosymbiotic bacterium Buchnera aphidicola, a symbiont of aphids. SecE is a critical component of the bacterial Sec translocase system, which facilitates the transport of preproteins across membranes during secretion. The recombinant form is engineered with an N-terminal His-tag for purification and expressed in Escherichia coli .

Production and Expression

The recombinant SecE is produced via heterologous expression in E. coli, leveraging the organism’s robust protein synthesis machinery. Key production parameters include:

ParameterSpecificationSource
Expression SystemE. coli
Purification TagsN-terminal His-tag
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0 (lyophilized) or 50% glycerol (liquid)
Reconstitution0.1–1.0 mg/mL in deionized water; add 5–50% glycerol for long-term storage

Applications in Research

Recombinant SecE is utilized in various biochemical and molecular biology assays:

ApplicationMethodologySource
SDS-PAGEPurification and purity verification
Western Blot (WB)Detection of SecE in Buchnera-aphid samples
ELISAQuantitative analysis of SecE expression levels

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
secE; BUsg_041; Protein translocase subunit SecE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
secE
Target Protein Sequence
MKIRIPDQKKAKNLEKIKWFFITAIFITSFFINNFFDKIGYFTRISIITLLVVFAISIAL YTKKVKNVFVYINASKNEMKKITWPQYKETLYTTFIIISVTILISLLLWGLDSIIFRLIA FIISVRF
Uniprot No.

Target Background

Function

Essential subunit of the Sec protein translocation channel SecYEG. It clamps together the two halves of SecY and may interact with the channel plug during translocation.

Database Links
Protein Families
SecE/SEC61-gamma family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and why is its SecE protein significant?

Buchnera aphidicola is an obligate endosymbiotic bacterium found within aphids, specifically within specialized cells called bacteriocytes. The relationship between Buchnera and aphids is mutualistic, with the bacterium providing essential amino acids that are lacking in the aphid's diet of plant phloem sap .

SecE is a critical component of the Sec protein translocation system, forming part of the core SecYEG translocon complex that facilitates protein transport across the bacterial cytoplasmic membrane. Despite Buchnera's dramatically reduced genome (approximately 640 kb compared to E. coli's 4.6 Mb), it has retained secE, indicating this gene's essential function in the endosymbiont's survival . The preservation of protein secretion machinery in this minimalist genome underscores the fundamental importance of protein translocation even in highly specialized symbiotic bacteria.

How does Buchnera SecE compare structurally and functionally to homologs in free-living bacteria?

Comparative genomic analyses indicate that Buchnera proteins generally share 47-80% amino acid sequence identity with their E. coli homologs . This relatively high conservation reflects their close evolutionary relationship, as Buchnera is a member of the gamma-3 subdivision of Proteobacteria that includes E. coli .

SecE in Buchnera likely maintains the core functional domains necessary for its role in the SecYEG translocon while potentially having lost regulatory features present in free-living bacteria. The protein is expected to show the characteristic AT-bias of the Buchnera genome in its nucleotide sequence . Computational studies predict that proteins in Buchnera generally have reduced folding efficiency compared to proteins of free-living bacteria, which may affect SecE structure and function .

From an evolutionary perspective, SecE exemplifies how essential cellular machinery can be maintained despite massive genomic reduction. The protein likely retains its fundamental role in stabilizing SecY and facilitating protein translocation across the cytoplasmic membrane, while adapting to the specialized intracellular environment of the bacteriocyte.

What techniques are used to detect and study SecE expression in Buchnera?

Studying gene expression in obligate endosymbionts like Buchnera presents unique challenges due to their uncultivable nature. Researchers employ several complementary approaches:

  • Reverse Transcriptase PCR: Similar to techniques used to detect expression of amino acid biosynthesis genes in Buchnera , RT-PCR can be used to detect secE mRNA transcripts directly from bacteriocytes isolated from aphid hosts.

  • Transcriptomic Analysis: RNA sequencing of bacteriocyte contents can provide comprehensive data on secE expression levels and how they respond to environmental conditions. Previous studies have shown that Buchnera gene expression changes are confined to a narrow range even under extreme environmental variations .

  • Proteomic Approaches: Mass spectrometry-based proteomics can detect SecE protein in bacteriocyte samples, though the membrane-associated nature of SecE makes this technically challenging.

  • Immunolocalization: Using antibodies raised against recombinant SecE, researchers can visualize the protein's location within bacteriocytes using immunofluorescence microscopy or immunogold electron microscopy.

  • Heterologous Expression: Recombinant expression systems allow production of Buchnera SecE for functional and structural studies when direct observation in the native context is not feasible .

What evolutionary patterns are observed in Buchnera SecE compared to other proteins?

The evolution of SecE in Buchnera follows patterns consistent with proteins involved in fundamental cellular processes. Research on translational robustness in Buchnera has demonstrated that:

  • Proteins involved in fundamental cellular processes (like components of the Sec translocation system) have been largely determined by selection for translational robustness . This means they evolve to maintain proper folding despite potential translation errors.

  • This contrasts with metabolic proteins, which have been under stronger selection for translational efficiency .

  • Despite massive genome reduction, Buchnera genomes show nearly perfect gene-order conservation, indicating that genome stasis was established early in the symbiosis (approximately 200 million years ago) .

  • While extensive genome reduction occurred early, gene loss continues at a slower rate among extant lineages .

The selective pressure on SecE likely reflects its essential role in protein translocation across the cytoplasmic membrane, a process critical for bacterial survival even in the specialized endosymbiotic context.

What are the challenges in producing recombinant Buchnera SecE?

Producing functional recombinant SecE from Buchnera presents several technical challenges:

  • Membrane Protein Expression: As an integral membrane protein, SecE is hydrophobic and often difficult to express in soluble form without aggregation.

  • Codon Usage Bias: Buchnera genomes are AT-rich, requiring codon optimization for efficient expression in heterologous systems like E. coli.

  • Proper Folding: Ensuring correct folding is challenging, especially given findings that Buchnera proteins generally have reduced folding efficiency .

  • Complex Formation: SecE normally functions as part of the SecYEG complex, and isolation may affect stability and function.

  • Degradation: Overexpressed membrane proteins may be recognized as misfolded and targeted for degradation by host cell proteases.

These challenges necessitate careful optimization of expression conditions, potentially including fusion tags to enhance solubility, specialized E. coli strains designed for membrane protein expression, and gentle solubilization protocols using appropriate detergents.

How does genome reduction in Buchnera affect the Sec translocation system?

The extreme genome reduction in Buchnera aphidicola has significant implications for protein translocation:

  • Streamlined Substrate Pool: With only approximately 570-590 protein-coding genes compared to E. coli's ~4,300, Buchnera's Sec machinery handles a much smaller and specialized subset of proteins .

  • Conservation of Core Components: Despite losing many genes, Buchnera has retained the essential components of the Sec system, including secE, indicating strong selection pressure to maintain protein secretion capability .

  • Reduced Regulatory Complexity: Many regulatory systems have been lost in Buchnera, suggesting that protein translocation may operate with fewer regulatory controls than in free-living bacteria .

  • Chaperone Dependency: The overexpression of the chaperonin GroEL in Buchnera (comprising ~10% of total protein) likely helps compensate for potential protein folding issues, including those affecting Sec components .

This reduction presents a unique opportunity to study a minimalist protein translocation system that has been streamlined through millions of years of symbiotic evolution while maintaining essential functionality.

What methods can be used to assess functional activity of recombinant Buchnera SecE?

Assessing the functionality of recombinant Buchnera SecE requires creative approaches given the organism's uncultivable nature:

  • Complementation Assays:

    • Using conditional E. coli secE mutants to test whether Buchnera SecE can restore function

    • Quantitative measurement of growth rates and protein secretion efficiency

    • Analysis of suppression of temperature-sensitive phenotypes

  • Reconstitution Studies:

    • Co-purification of Buchnera SecE with E. coli SecY and SecG

    • Reconstitution into proteoliposomes

    • In vitro translocation assays using fluorescently labeled substrate proteins

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy to confirm secondary structure elements

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to measure protein stability

  • Binding Studies:

    • Surface plasmon resonance or microscale thermophoresis to measure interactions with other Sec components

    • Co-immunoprecipitation to identify protein-protein interactions

    • Cross-linking coupled with mass spectrometry to map interaction sites

These complementary approaches can provide evidence for functionality despite being unable to study the protein in its native context.

How does sequence variation in SecE across Buchnera strains reflect host adaptation?

Comparative analysis of SecE sequences across different Buchnera strains can reveal evolutionary patterns related to host adaptation:

Buchnera StrainAphid HostGenome Size (kb)Pattern of SecE Evolution
B. aphidicola APSAcyrthosiphon pisum640Reference strain
B. aphidicola SgSchizaphis graminum630Host-specific adaptation
B. aphidicola BCcCinara cedri422Most reduced genome
B. aphidicola BPBaizongia pistaciae618Shows population polymorphism

While detailed SecE sequence comparisons are not provided in the available literature, we can infer patterns based on general evolutionary trends in Buchnera:

  • Core Functional Domains: These are likely highly conserved across strains due to the essential nature of protein translocation.

  • Variable Regions: Non-critical regions may show higher variation, potentially reflecting adaptation to different host environments.

  • Coevolution Patterns: SecE likely shows coordinated evolution with SecY and other interacting partners, maintaining functional interfaces.

  • Translational Robustness: As identified in , proteins involved in fundamental cellular processes show evidence of selection for translational robustness, which may be reflected in SecE codon usage patterns.

The B. aphidicola strain from Cinara cedri has experienced the most extreme genome reduction and shows the strongest signal of translational robustness , suggesting it has reached a minimal viable gene set for endosymbiotic life. Analysis of SecE in this strain could provide insights into the most essential features of this protein.

How does the SecE-dependent protein secretion pathway contribute to the symbiotic relationship?

The SecE-dependent protein translocation system plays several critical roles in maintaining the symbiotic relationship between Buchnera and its aphid host:

  • Nutrient Exchange: Sec-dependent secretion likely facilitates the export of essential amino acids and other nutrients synthesized by Buchnera for the aphid host. Genomic studies confirm that Buchnera retains genes for biosynthesis of essential amino acids lacking in the aphid's diet .

  • Membrane Protein Integration: The Sec system is responsible for integrating proteins into the bacterial inner membrane, maintaining cellular integrity within the specialized bacteriocyte environment.

  • Signal Transduction: Though Buchnera has lost many regulatory systems, remaining membrane proteins inserted via the Sec pathway may facilitate sensing of the host environment.

  • Symbiosis Maintenance: Proper protein targeting and secretion is likely essential for maintaining the delicate balance of the symbiotic relationship established over 200 million years ago .

The retention of secE in the highly reduced Buchnera genome, alongside other components of the Sec pathway, underscores its essential role in symbiotic function. The system may have evolved specific adaptations for efficiently translocating proteins involved in nutrient exchange with the host.

What insights can structural studies of recombinant Buchnera SecE provide about endosymbiont evolution?

Structural studies of recombinant Buchnera SecE could provide several important insights into endosymbiont evolution:

  • Adaptation to Membrane Environment: Structural features might reveal adaptations to the specialized membrane composition of endosymbionts living within bacteriocytes.

  • Minimal Functional Requirements: By comparing with SecE structures from free-living bacteria, we could identify the minimal structural elements required for function.

  • Evolutionary Constraints: Mapping conserved regions could highlight domains under strongest purifying selection, revealing functional constraints that have persisted despite 200 million years of endosymbiotic lifestyle.

  • Translational Robustness Features: Structural analysis might identify features that enhance protein stability and proper folding despite potential translation errors, as suggested by studies on translational robustness in Buchnera .

  • Partner Interactions: Co-crystallization with interacting proteins could reveal how the SecYEG complex has co-evolved in endosymbionts, potentially showing streamlined interaction interfaces.

These structural insights would contribute to our understanding of how essential cellular machinery adapts during long-term endosymbiosis and genome reduction, potentially providing a model for predicting evolutionary trajectories in other host-associated microorganisms.

What expression systems are optimal for producing functional Buchnera SecE?

Producing functional recombinant SecE from Buchnera requires specialized expression systems optimized for membrane proteins:

Expression SystemAdvantagesLimitationsBest Applications
E. coli C41/C43(DE3)Designed for toxic membrane proteinsMay still aggregateInitial screening
E. coli Lemo21(DE3)Tunable expression levelsMore complex systemOptimization studies
Cell-free expressionAvoids toxicity issuesLower yieldsRapid screening
Pichia pastorisEukaryotic folding machineryLonger timeframeScale-up production
Nanodiscs/LiposomesNative-like environmentTechnical complexityFunctional studies

Key optimization strategies include:

  • Codon optimization to address the AT-rich bias of Buchnera genes while maintaining translational robustness features.

  • Use of fusion partners (MBP, SUMO) to enhance solubility and proper membrane insertion.

  • Low-temperature induction (16-20°C) to slow expression rate and promote proper folding.

  • Addition of specific phospholipids to mimic the Buchnera membrane environment.

  • Co-expression with chaperones to facilitate proper folding, mimicking the high GroEL levels observed in Buchnera .

Empirical testing of multiple conditions is typically necessary, with functional assays guiding optimization efforts.

What purification strategies are effective for Buchnera membrane proteins?

Purifying membrane proteins like SecE requires specialized approaches:

  • Membrane Extraction Protocol:

    • Gentle cell lysis (e.g., French press or sonication)

    • Membrane isolation via ultracentrifugation

    • Systematic detergent screening (starting with mild detergents like DDM, LMNG)

    • Solubilization optimization (detergent:protein ratio, temperature, time)

  • Chromatography Strategy:

    • Initial IMAC purification using His-tag

    • Secondary purification via size exclusion chromatography

    • Optional ion exchange chromatography for removing contaminants

  • Stabilization Approaches:

    • Addition of lipids (E. coli total extract or defined mixtures)

    • Glycerol (10-20%) to prevent aggregation

    • Specific additives like cholesterol hemisuccinate or cardiolipin

  • Alternative Membrane Mimetics:

    • Reconstitution into nanodiscs for a native-like membrane environment

    • Amphipols for enhanced stability

    • Styrene maleic acid lipid particles (SMALPs) for native lipid co-extraction

  • Quality Control Metrics:

    • SEC-MALS to assess oligomeric state

    • Negative-stain EM to check homogeneity

    • Thermal stability assays to optimize buffer conditions

The critical step is maintaining the protein in a native-like environment throughout purification to preserve structure and function for downstream applications.

What molecular biology techniques can be used to study Buchnera SecE interactions?

Several molecular biology techniques can elucidate Buchnera SecE interactions:

  • Bacterial Two-Hybrid Systems:

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) assay to detect protein-protein interactions

    • Split-ubiquitin system for membrane protein interactions

    • Quantification via β-galactosidase activity measurements

  • In vitro Cross-linking:

    • Chemical cross-linkers with various spacer lengths

    • Photo-activatable amino acid incorporation for site-specific cross-linking

    • Cross-linking coupled with mass spectrometry (XL-MS) for interaction mapping

  • Förster Resonance Energy Transfer (FRET):

    • Fluorescent protein fusions to detect proximity in vivo

    • Site-specific labeling with fluorescent dyes for in vitro studies

    • Measurement of interaction dynamics in real-time

  • Surface Plasmon Resonance (SPR):

    • Kinetic measurements of SecE interactions with other Sec components

    • Determination of binding affinities and on/off rates

    • Evaluation of the effects of mutations on binding properties

  • Co-evolution Analysis:

    • Identification of co-evolving residue pairs between SecE and interaction partners

    • Mapping onto structural models to predict interaction interfaces

    • Validation through site-directed mutagenesis

These techniques can provide complementary data about SecE interactions, helping to understand how this essential component functions within the specialized context of the endosymbiont.

What structural biology methods are most suitable for Buchnera SecE characterization?

Multiple structural biology approaches are applicable to Buchnera SecE characterization:

For SecE specifically:

  • Cryo-EM is particularly suitable for visualizing SecE in the context of the full SecYEG complex, potentially revealing how the minimal Buchnera system differs from more complex bacterial translocons.

  • Site-directed spin labeling coupled with EPR could provide valuable information about SecE dynamics during the translocation cycle.

  • Cross-linking mass spectrometry can map interaction interfaces between SecE and other components of the translocation machinery.

  • Integrative structural biology approaches, combining multiple methods, would provide the most comprehensive characterization.

Computational approaches like molecular dynamics simulations can complement experimental data, particularly in predicting how Buchnera-specific sequence variations might affect function.

How can we study the role of SecE in protein translocation mechanisms specific to endosymbionts?

Investigating SecE's role in endosymbiont-specific protein translocation requires innovative approaches:

  • Comparative Reconstitution Systems:

    • In vitro reconstitution of pure Buchnera SecYEG components

    • Side-by-side comparison with E. coli equivalents

    • Quantitative assessment of translocation efficiency using model substrates

    • Measurement of differences in substrate specificity

  • Hybrid Translocon Construction:

    • Creation of chimeric SecYEG complexes with components from both Buchnera and E. coli

    • Mapping of domains responsible for endosymbiont-specific properties

    • Identification of critical residues through site-directed mutagenesis

  • Substrate Specificity Analysis:

    • Testing translocation of Buchnera-specific proteins involved in symbiosis

    • Identification of signal sequences or motifs unique to endosymbiont proteins

    • Comparison of translocation efficiency for different substrate classes

  • Environmental Response:

    • Analysis of translocation under conditions mimicking the bacteriocyte environment

    • Testing effects of pH, osmolarity, and ion concentrations on translocation efficiency

    • Evaluation of stress response mechanisms in the streamlined Buchnera system

  • Systems Biology Approach:

    • Integration of proteomics, structural biology, and functional assays

    • Modeling of the entire translocation process in the context of the reduced Buchnera proteome

    • Prediction of how genome reduction has influenced secretory pathway function

Such studies would illuminate how essential cellular machinery has adapted to the endosymbiotic lifestyle and contribute to our understanding of minimal functional requirements for protein translocation systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.