Recombinant Buchnera aphidicola subsp. Schizaphis graminum Probable intracellular septation protein A (BUsg_264)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; BUsg_264; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
BUsg_264
Target Protein Sequence
MKKILNLLPIFTFFIFYRFYDIFIASKSLIFISGLTCLLYWIIYKEIDKINLFSFITIAI FGSLTIIFHNSQFIKWKITIIYMIFSVILFISQFFMKKPIIQRFLEKDIKISDLYWKKIN FFWALFFLFCSILNIYVALCLPEKIWVNFKVFGLSFLMFLSILITSIYINFKMLKEK
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and why is it significant for research?

Buchnera aphidicola is a primary obligate bacterial endosymbiont found in aphids. Its significance stems from its essential role in supplying aphids with nutrients lacking in their phloem-sap diet. The symbiotic relationship between Buchnera and aphids represents one of the most well-studied examples of obligate endosymbiosis in insects. Buchnera typically resides within specialized host cells called bacteriocytes and has coevolved with aphids for millions of years .

This system is particularly valuable for studying molecular evolution, genome reduction, and symbiotic interactions. Recent research has demonstrated significant coevolution between Buchnera and its aphid hosts at individual, species, generic, and tribal levels, making it an excellent model for understanding host-microbe interactions .

What is the function of the Probable Intracellular Septation Protein A (BUsg_264) in Buchnera aphidicola?

The Probable Intracellular Septation Protein A (BUsg_264) in Buchnera aphidicola is believed to play a crucial role in cell division processes. Based on homology with similar proteins in other bacteria, it is hypothesized to be involved in septum formation during bacterial cell division. This protein is also known as Inner membrane-spanning protein YciB, suggesting its localization at the bacterial inner membrane .

The protein consists of 177 amino acids and contains transmembrane domains, as evident from its amino acid sequence which includes hydrophobic regions characteristic of membrane-spanning proteins. These structural features are consistent with its putative role in cellular septation processes essential for Buchnera's survival and reproduction within aphid bacteriocytes .

How does Buchnera aphidicola contribute to aphid nutrition?

Buchnera aphidicola provides essential nutrients that are absent or limited in the aphid's phloem sap diet. Specifically, Buchnera synthesizes essential amino acids that aphids cannot produce themselves or obtain from their diet in sufficient quantities. This nutritional provisioning is the foundation of the obligate symbiotic relationship between Buchnera and aphids .

The genome of Buchnera has undergone significant reduction during coevolution with aphids, but it has retained genes essential for amino acid biosynthesis. In some aphid lineages, Buchnera has lost certain symbiotic functions, necessitating complementation by additional symbionts in what are known as dual or co-obligate symbioses. These metabolic complementation patterns vary across different aphid lineages and represent fascinating examples of convergent evolution in symbiotic systems .

What methodologies are recommended for experimental studies of recombinant BUsg_264 protein?

When designing experiments with recombinant BUsg_264 protein, researchers should consider the following methodological approaches:

  • Protein Expression and Purification: The recombinant protein can be expressed in E. coli with an N-terminal His tag to facilitate purification. The expressed protein should be purified to >90% purity as determined by SDS-PAGE .

  • Storage and Handling: Researchers should aliquot the purified protein and store at -20°C/-80°C to avoid repeated freeze-thaw cycles. For working solutions, storage at 4°C for up to one week is recommended. The protein is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage .

  • Functional Assays: For functional characterization, researchers can employ bacterial two-hybrid systems, protein localization studies using fluorescence microscopy, and in vitro cell division assays to assess the protein's role in septation.

  • Structural Analysis: Techniques such as circular dichroism spectroscopy, X-ray crystallography, or NMR spectroscopy can provide insights into the protein's secondary and tertiary structure, which is crucial for understanding its membrane-spanning properties.

How can researchers design single-subject experiments to study BUsg_264 protein function in aphid-Buchnera symbiosis?

When studying the function of BUsg_264 protein in the context of aphid-Buchnera symbiosis, single-subject experimental designs offer valuable approaches:

  • Individual Aphids as Their Own Controls: This approach allows researchers to measure the effects of experimental manipulations (such as RNAi targeting BUsg_264) on individual aphids, where each subject serves as its own control. This controls for individual variation that might mask treatment effects in group designs .

  • Repeated Measures Design: Researchers can collect multiple data points before, during, and after experimental manipulation of BUsg_264 expression or function. This approach provides a temporal profile of protein effects and enhances statistical power .

  • Verification through Replication: The function of BUsg_264 should be verified through systematic replication across multiple individual aphids, potentially from different clonal lines to account for genetic background effects .

  • Prediction and Verification: Researchers should establish clear predictions about how manipulation of BUsg_264 will affect specific aspects of the symbiosis, bacterial division, or aphid physiology, followed by rigorous verification of these predictions through controlled experimental manipulation .

What genomic approaches reveal insights into BUsg_264 evolution in Buchnera-aphid coevolution?

Genomic analyses have revealed several important aspects of BUsg_264 evolution within the context of Buchnera-aphid coevolution:

What are the critical considerations when designing protein interaction studies with recombinant BUsg_264?

When investigating protein interactions involving recombinant BUsg_264, researchers should consider:

  • Protein Solubility and Conformation: As a membrane-spanning protein, BUsg_264 may present challenges for in vitro interaction studies. Detergent selection is critical for maintaining native conformation while solubilizing the protein. Consider using mild detergents such as DDM (n-Dodecyl β-D-maltoside) or CHAPS .

  • Tag Interference: While the N-terminal His tag facilitates purification, researchers should verify that it doesn't interfere with protein interactions. Control experiments using alternative tag positions or tag-free protein may be necessary .

  • Interaction Partner Selection: Based on its role in septation, potential interaction partners include other cell division proteins, peptidoglycan synthesis enzymes, and membrane-anchoring proteins. Candidate approach based on known division machinery components in model bacteria can guide partner selection.

  • Validation Methods: Employ multiple complementary techniques for interaction validation, including:

    • Pull-down assays with recombinant proteins

    • Bacterial two-hybrid systems

    • Fluorescence resonance energy transfer (FRET)

    • Co-immunoprecipitation from Buchnera extracts (challenging due to cultivation difficulties)

How can researchers overcome challenges in functional characterization of BUsg_264 given Buchnera's uncultivable nature?

The obligate endosymbiotic lifestyle of Buchnera aphidicola presents significant challenges for functional studies as it cannot be cultured outside its host. Researchers can employ these approaches to overcome these limitations:

  • Heterologous Expression Systems: Express BUsg_264 in model bacteria like E. coli, particularly in strains with mutations in homologous genes (e.g., yciB) to assess functional complementation .

  • In vivo Imaging: Develop fluorescent protein fusions with BUsg_264 for microinjection into aphid bacteriocytes, followed by confocal microscopy to track localization during Buchnera cell division.

  • RNA Interference: Design dsRNA targeting BUsg_264 for injection into aphids to knock down gene expression, followed by phenotypic analysis of Buchnera division and septation.

  • Genomic Context Analysis: Compare the genomic neighborhood of BUsg_264 across different Buchnera strains to identify conserved gene clusters that might indicate functional associations.

  • Structural Modeling: Employ computational approaches to model BUsg_264 structure based on crystallized homologs, generating hypotheses about functional domains that can be tested experimentally.

What are the best practices for presenting research data on BUsg_264 protein characterization?

When presenting research findings on BUsg_264 protein characterization, researchers should follow these best practices:

  • Simplicity and Clarity: Keep data presentation simple and focused on answering key research questions. Select the most relevant findings rather than presenting all generated data .

  • Appropriate Use of Tables and Figures: Use tables for precise numerical data and figures for patterns or trends. For BUsg_264 characterization, consider including:

    • Tables for amino acid composition, physicochemical properties, and interaction partners

    • Figures for protein structure predictions, localization patterns, and functional assay results

  • Data Visualization: For complex datasets, use appropriate visualization techniques that highlight key findings. For example, protein sequence conservation across Buchnera strains can be effectively presented as sequence logos or heat maps .

  • Standard Formatting: Follow journal-specific requirements for data presentation. For most biological journals, protein characterization data should follow standards established by the Protein Society or similar organizations .

How should researchers analyze and interpret comparative genomic data for BUsg_264 across different Buchnera strains?

When analyzing comparative genomic data for BUsg_264 across different Buchnera strains, researchers should:

  • Sequence Alignment and Conservation Analysis: Perform multiple sequence alignments of BUsg_264 orthologs to identify conserved domains and variable regions. Calculate conservation scores for each amino acid position to identify functionally critical residues .

  • Phylogenetic Analysis: Construct phylogenetic trees based on BUsg_264 sequences and compare with host aphid phylogenies to identify patterns of coevolution. Statistical methods such as Procrustes analysis or ParaFit can quantify phylogenetic congruence .

  • Selective Pressure Analysis: Calculate dN/dS ratios (ratio of non-synonymous to synonymous substitution rates) to determine if BUsg_264 is under purifying selection, positive selection, or neutral evolution across different Buchnera lineages .

  • Genomic Context Comparison: Analyze the genomic neighborhood of BUsg_264 across strains to identify synteny conservation or disruption, which may indicate functional constraints or genomic rearrangements .

  • Correlation with Ecological Factors: Correlate sequence variation with ecological characteristics of host aphids to identify potential adaptive changes in BUsg_264 function related to host ecology.

What are the potential applications of BUsg_264 research in understanding symbiotic systems?

Research on BUsg_264 has broader implications for understanding symbiotic systems:

  • Model for Cell Division in Endosymbionts: As a protein involved in septation, BUsg_264 research can provide insights into how obligate endosymbionts maintain cell division machinery despite genome reduction. This has implications for understanding the minimal genetic requirements for bacterial reproduction .

  • Symbiont Control Mechanisms: Understanding the regulation and function of BUsg_264 could reveal mechanisms by which aphids potentially influence Buchnera cell division and population control within bacteriocytes.

  • Evolutionary Trajectory of Essential Functions: By studying how BUsg_264 has evolved across different Buchnera lineages, researchers can understand how essential cellular functions are maintained despite genome reduction and host adaptation .

  • Symbiosis Establishment and Maintenance: Insights from BUsg_264 function could illuminate aspects of how new symbiotic associations develop and are maintained, particularly in systems where multiple symbionts occupy the same host cells .

How might studies of BUsg_264 inform research on co-obligate symbiotic systems in aphids?

Studies of BUsg_264 can contribute significantly to understanding co-obligate symbiotic systems in aphids:

  • Functional Partitioning: In aphid lineages where Buchnera has acquired co-obligate partners, understanding how essential functions like cell division (involving BUsg_264) are maintained or modified could reveal principles of functional partitioning in multi-partner symbioses .

  • Genomic Complementation: The retention or modification of BUsg_264 in Buchnera genomes that have lost other essential functions may provide insights into which cellular processes are prioritized during genomic reduction .

  • Partner Coordination: Research on BUsg_264 and cell division in Buchnera could illuminate mechanisms of coordination between different symbionts in co-obligate systems, particularly how cell division rates are balanced between partners .

  • Evolutionary Transitions: Understanding the role of BUsg_264 across different aphid lineages, including those with single versus dual obligate symbionts, could help explain evolutionary transitions in symbiotic systems .

Table 1: Key Specifications of Recombinant BUsg_264 Protein

ParameterSpecificationNotes
Protein Length177 amino acids (Full Length)Positions 1-177 of native sequence
Expression SystemE. coliOptimized for bacterial expression
Fusion TagN-terminal His tagFacilitates purification via affinity chromatography
Molecular Weight~20 kDaIncluding His tag
Purity>90%As determined by SDS-PAGE
Storage FormLyophilized powderEnhances stability during shipping and storage
ReconstitutionDeionized sterile waterRecommended concentration: 0.1-1.0 mg/mL
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0Optimized for protein stability
Storage Conditions-20°C/-80°CAliquoting recommended to avoid freeze-thaw cycles
ApplicationsSDS-PAGE, protein interaction studiesSuitable for various in vitro applications

Data derived from product specifications

What are the key considerations for researchers beginning work with BUsg_264 protein?

Researchers new to studying BUsg_264 should consider these fundamental recommendations:

  • Start with Bioinformatic Analysis: Before experimental work, conduct thorough sequence analysis and structural prediction to generate functional hypotheses and identify critical domains.

  • Establish Appropriate Controls: When working with recombinant protein, include appropriate controls such as heat-denatured protein and buffer-only conditions to distinguish specific effects from artifacts .

  • Consider Evolutionary Context: Interpret BUsg_264 function within the evolutionary context of the Buchnera-aphid symbiosis, particularly the patterns of genome reduction and coevolution .

  • Multidisciplinary Approach: Combine molecular, cellular, and evolutionary approaches for a comprehensive understanding of BUsg_264 function and significance.

  • Collaboration: Given the specialized nature of this research, establish collaborations with experts in protein biochemistry, symbiosis research, and aphid biology to enhance experimental design and data interpretation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.