Recombinant Buchnera aphidicola subsp. Schizaphis graminum Probable protease sohB (sohB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Probable protease SohB (UniProt: Q8K9P8) is a 342-amino-acid protein classified under the S49 peptidase family (EC 3.4.21.-) . It is produced via heterologous expression systems to study its enzymatic activity and role in Buchnera aphidicola, a γ-proteobacterial endosymbiont essential for aphid survival . The gene sohB is conserved in Buchnera lineages, suggesting evolutionary importance in host-symbiont interactions .

Post-Translational Modifications

  • Tag: N-terminal 10xHis-tag for purification .

  • Storage: Stabilized in Tris-based buffer with 50% glycerol at -20°C or -80°C .

Enzymatic Activity

  • Role: Likely involved in proteolytic processing, analogous to E. coli SohB, which cleaves misfolded membrane proteins .

  • Regulation: No evidence of allosteric regulation, unlike homologs in free-living bacteria .

Genetic Context

  • Operon Structure: The sohB gene is monocistronic, contrasting with E. coli’s polycistronic operons .

  • Conservation: Retains 47–80% amino acid identity with proteases from related γ-proteobacteria .

Expression Systems

  • Host: In vitro E. coli expression systems .

  • Yield: ≥50 µg per batch, scalable upon request .

  • Purity: >85% via SDS-PAGE .

Optimization

  • Buffer: Tris-based, pH 7.4, with glycerol to prevent aggregation .

  • Stability: Degrades after repeated freeze-thaw cycles; working aliquots stored at 4°C for ≤1 week .

Experimental Uses

  • Symbiosis Studies: Investigates Buchnera’s role in aphid nutrient synthesis .

  • Enzyme Kinetics: Characterizes substrate specificity and inhibition .

Comparative Studies

FeatureB. aphidicola SohBHaemophilus influenzae SohBE. coli SohB
Length (aa)342330335
Host SystemE. coliE. coli/BaculovirusNative
Purity>85%>85%N/A
Tag10xHisVariedNone
Data derived from .

Future Directions

  • Structural Biology: Cryo-EM or X-ray crystallography to resolve active-site architecture.

  • Mutational Analysis: Identify residues critical for protease activity or host interaction.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
sohB; BUsg_272; Probable protease SohB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
sohB
Target Protein Sequence
MNLLLNYELFLAKAITFLFIIFITPFIFNIIKRKRTDQKKFKIILLEEKYKNIKKDILLS KMNKLEKKKWIKEEKKKDKEFEKKNKNNIVTLKKKTLFVLDFKGGIHAHEVIGLREEISA ILLAANKDDEVLLRLESSGGVIHGYGLAAAQLERLRQNKIRLIISIDKIAASGGYMMACV ADYIISAPFAIIGSIGVVGQLPNFNKLLKKCNIDVELHTAGDYKRTLTMFGQNTELTRKK FCQELNLTHEIFKKFIKKMRPCLDIENISNGEHWFGTIAFKKNLVDEINTSDNILMSKMK EKYTLLNIQYIYKNKKLENFTSFIIENIKIIIIKIFSYKKIL
Uniprot No.

Target Background

Function
Possible protease.
Database Links
Protein Families
Peptidase S49 family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Buchnera aphidicola and why is it significant in symbiosis research?

Buchnera aphidicola is an obligate bacterial endosymbiont harbored by aphids in specialized cells called bacteriocytes. This symbiosis represents one of the most well-studied cases of obligate mutualism in insects. The relationship is essential for both organisms: Buchnera cannot survive outside the host aphid, and aphids lacking Buchnera exhibit decreased growth and significantly reduced fertility .

The significance of this symbiotic relationship extends across multiple biological domains:

  • Evolutionary biology: The coevolution between Buchnera and aphids has resulted in extreme genome reduction in the bacterium, making it an excellent model for studying endosymbiont evolution

  • Nutritional biochemistry: Buchnera provides essential nutrients to aphids, enabling them to survive on phloem sap

  • Agricultural science: Understanding aphid-Buchnera interactions may reveal novel approaches to pest management

Methodologically, researchers studying this system must employ specialized techniques due to Buchnera being unculturable outside its host. These include:

  • Genomic and transcriptomic analyses of both partners

  • Fluorescence microscopy to visualize bacteriocytes

  • Antibiotic treatments to create aposymbiotic aphids for comparative studies

  • Artificial diet systems for manipulating symbiont populations

What is the molecular structure and characteristics of the sohB protein?

The sohB protein from Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) is characterized by the following molecular features:

  • Full amino acid sequence consisting of 342 amino acids (see Table 1)

  • UniProt accession number: Q8K9P8

  • Classified as a probable serine protease (EC 3.4.21.-)

  • Gene name: sohB, with locus name BUsg_272

Table 1: Amino Acid Sequence of Buchnera aphidicola sohB

Sequence PositionAmino Acid Sequence
1-60MNLLLNYELFLAKAITFLFIIFITPFIFNIIKRKRTDQKKFKIILLEEKYKNIKKDILLS
61-120KMNKLEKKKWIKEEKKKDKEFEKKNKNNIVTLKKKTLFVLDFKGGIHAHEVIGLREEISA
121-180ILLAANKDDEVLLRLESSGGVIHGYGLAAAQLERLRQNKIRLIISIDKIAASGGYMMACV
181-240ADYIISAPFAIIGSIGVVGQLPNFNKLLKKCNIDVELHTAGDYKRTLTMFGQNTELTRKK
241-300FCQELNLTHEIFKKFIKKMRPCLDIENISNGEHWFGTIAFKKNLVDEINTSDNILMSKMK
301-342EKYTLLNIQYIYKNKKLENFTSFIIENIKIIIIKIFSYKKIL

Based on homology to the sohB gene in Escherichia coli, this protein likely contains a signal sequence at the N-terminus and functions as a periplasmic protease . The E. coli sohB encodes a 39,000-Mr precursor protein that is processed to a 37,000-Mr mature form, with predicted signal sequence cleavage between amino acids 22 and 23 . Similar processing may occur in the Buchnera sohB protein.

Methodological approaches to further characterize the protein structure include:

  • Homology modeling based on related bacterial proteases

  • Secondary structure prediction using computational tools

  • X-ray crystallography or cryo-electron microscopy of purified recombinant protein

  • Circular dichroism spectroscopy to determine secondary structure elements

How is recombinant Buchnera aphidicola sohB typically produced for research applications?

Production of recombinant Buchnera aphidicola sohB requires careful consideration of expression systems, purification strategies, and quality control measures. The following methodological framework has proven effective:

Expression system selection:

  • Escherichia coli is the most commonly used heterologous host for bacterial protein expression

  • Plant-based expression systems have shown promise for certain recombinant proteins and could be considered as alternatives

Vector design considerations:

  • Inclusion of appropriate affinity tags (His-tag, GST) for purification

  • Codon optimization for the chosen expression host

  • Strategic placement of fusion partners to enhance solubility

  • The B1 domain of Streptococcal protein G (GB1) has been demonstrated to enhance expression levels of various target proteins when used as a fusion partner

Expression optimization protocol:

  • Transform expression constructs into appropriate E. coli strains (BL21(DE3), Rosetta, etc.)

  • Screen multiple colonies for expression levels

  • Optimize induction conditions (temperature, inducer concentration, duration)

  • Test different media formulations to maximize yield

  • Consider co-expression with chaperones if initial solubility is poor

Purification strategy:

  • Cell lysis under conditions that maintain protein stability

  • Initial capture using affinity chromatography (typically Ni²⁺-NTA for His-tagged proteins)

  • Secondary purification steps (ion exchange, size exclusion chromatography)

  • Concentration and buffer exchange to final storage conditions

  • Storage in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended shelf life

For applications requiring tag removal, the inclusion of a TEV protease recognition site allows for specific cleavage of fusion tags under controlled conditions .

What is the function of sohB protease in Buchnera aphidicola based on current evidence?

The function of sohB in Buchnera aphidicola remains an active area of investigation, but several lines of evidence suggest important physiological roles:

Based on homology to E. coli sohB, the protein likely functions as a periplasmic protease . In E. coli, sohB can partially compensate for the missing HtrA (DegP) protein function when overexpressed, suggesting a role in protein quality control . HtrA is a periplasmic protease required for bacterial viability at high temperatures, indicating that sohB may similarly contribute to stress tolerance .

The specific substrates and precise cellular functions of Buchnera aphidicola sohB may include:

  • Quality control of periplasmic proteins:

    • Recognition and degradation of misfolded proteins

    • Preventing accumulation of protein aggregates under stress conditions

  • Processing of specific substrates:

    • Potential cleavage of signal peptides, similar to E. coli protease IV

    • Maturation of proteins involved in nutrient exchange with the host

  • Contribution to symbiosis maintenance:

    • Possible role in processing proteins at the symbiont-host interface

    • Maintenance of cell envelope integrity in the specialized bacteriocyte environment

Methodological approaches to investigate these potential functions include:

  • In vitro protease assays with defined substrates

  • Comparative proteomics between wild-type and sohB-depleted systems

  • Transcriptional analysis under various stress conditions

  • Biochemical characterization of purified recombinant sohB

What methodological approaches can determine the substrate specificity of sohB protease?

Elucidating the substrate specificity of sohB protease requires a multi-faceted approach combining biochemical, proteomic, and computational methods:

In vitro screening approaches:

  • Fluorogenic peptide libraries: Screen diverse peptide sequences with fluorophore/quencher pairs to identify cleaved sequences

  • Positional scanning synthetic combinatorial libraries (PS-SCL): Systematically vary amino acids at each position relative to the cleavage site

  • Biotinylated peptide libraries immobilized on streptavidin surfaces for high-throughput analysis

Proteomic approaches:

  • Differential proteomics comparing wild-type and sohB-deficient systems

  • Terminal amine isotopic labeling of substrates (TAILS) to identify N-termini generated by proteolytic cleavage

  • Stable isotope labeling with amino acids in cell culture (SILAC) to quantify changes in protein abundance

Table 2: Recommended Experimental Design for Substrate Identification

ApproachMethodologyExpected OutcomeLimitations
Peptide Library ScreeningCombinatorial libraries with detection of cleaved productsInitial cleavage motifArtificial context
Comparative ProteomicsMS/MS analysis of proteins from systems with/without active sohBIdentification of in vivo substratesIndirect effects
N-terminal ProteomicsEnrichment for newly generated N-terminiDirect identification of cleavage sitesTechnical complexity
Structural ModelingDocking simulations with potential substratesSubstrate binding predictionsRequires validation

Validation strategies:

  • Site-directed mutagenesis of predicted catalytic residues (typically Ser, His, Asp for serine proteases)

  • Generation of catalytically inactive variants as negative controls

  • Determination of enzyme kinetics (Km, kcat, specificity constants) for validated substrates

  • Co-immunoprecipitation to confirm physical interactions with substrates

Given the homology to E. coli protease IV, which processes signal peptides , special attention should be given to testing signal sequences from proteins involved in the Buchnera-aphid symbiosis as potential substrates.

How does temperature affect sohB function in the context of Buchnera-aphid symbiosis?

Temperature is a critical factor in the Buchnera-aphid symbiosis, and research indicates that thermal stress significantly impacts this relationship . A comprehensive investigation of temperature effects on sohB requires integration of molecular, biochemical, and ecological approaches:

Expression and abundance analysis:

  • Quantitative RT-PCR to measure sohB transcript levels across temperature gradients

  • Western blotting or targeted proteomics to quantify sohB protein abundance

  • Reporter gene constructs to visualize expression patterns in situ

Temperature-dependent enzymatic activity:

  • Development of fluorogenic substrate assays optimized for sohB

  • Determination of enzyme kinetic parameters (Km, kcat) at different temperatures

  • Assessment of thermal stability using differential scanning fluorimetry

Structural adaptations to temperature:

  • Circular dichroism spectroscopy to monitor secondary structure changes with temperature

  • Intrinsic fluorescence measurements to detect tertiary structure alterations

  • Hydrogen-deuterium exchange mass spectrometry to identify temperature-sensitive regions

Research on Buchnera has demonstrated that single nucleotide mutations in heat-shock genes can dramatically affect aphid thermal tolerance. For instance, a mutation in the heat-shock transcriptional promoter for ibpA virtually eliminates its response to heat stress, dramatically affecting host fitness in a temperature-dependent manner . This finding suggests that heat-shock and stress-response proteins like sohB may be critical determinants of symbiotic success under variable thermal conditions.

Table 3: Predicted Temperature Effects on sohB Properties Based on Related Proteases

Temperature RangeExpected Effect on sohBPotential Impact on Symbiosis
Below 15°CReduced catalytic activity, maintained stabilitySlower protein processing, potential metabolic bottlenecks
15-25°C (optimal)Balanced activity and stabilityNormal symbiotic function
25-30°CIncreased activity, onset of structural instabilityEnhanced processing, potential destabilization at upper range
Above 30°CSignificant denaturation risk, activity lossSymbiotic breakdown, proteotoxic stress

Methodological considerations should include careful temperature control during all experiments and the use of appropriate temperature-matched controls to distinguish direct temperature effects from indirect physiological responses.

What role does sohB play in maintaining the obligate symbiotic relationship?

The obligate nature of the Buchnera-aphid symbiosis suggests that essential processes are dependent on this relationship. Investigating the specific role of sohB in this symbiosis requires multiple experimental approaches:

Molecular interaction studies:

  • Yeast two-hybrid or bacterial two-hybrid screens to identify aphid proteins interacting with sohB

  • Co-immunoprecipitation followed by mass spectrometry to validate protein-protein interactions

  • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to sohB in vivo

Functional perturbation approaches:

  • RNA interference targeting sohB expression

  • Administration of specific protease inhibitors through aphid feeding

  • Overexpression of dominant-negative sohB variants

Physiological impact assessment:

  • Metabolomic profiling to identify changes in nutrient exchange

  • Measurement of aphid fitness parameters (growth rate, fecundity, survival)

  • Quantification of Buchnera population dynamics within bacteriocytes

Buchnera cannot survive outside the host aphid, and aphids lacking Buchnera show decreased growth and fertility . If sohB is involved in processing proteins critical for nutrient exchange or symbiont maintenance, disruptions to its function could have significant consequences for both partners. The study of this protein may provide insights into the molecular underpinnings of this ancient and highly integrated symbiotic relationship.

How can advanced genomic and transcriptomic approaches provide insights into sohB regulation?

Understanding the regulation and evolution of sohB in Buchnera aphidicola requires sophisticated genomic and transcriptomic methodologies:

Comparative genomic analyses:

  • Synteny analysis across multiple Buchnera strains to identify conserved gene neighborhoods

  • Identification of regulatory elements in promoter regions

  • Detection of selection signatures using dN/dS ratios and other evolutionary metrics

  • Reconstruction of evolutionary history through phylogenetic analysis

Transcriptomic approaches:

  • RNA-Seq under various environmental conditions to identify co-regulated genes

  • 5' RACE to map transcription start sites and characterize promoter elements

  • Ribosome profiling to assess translation efficiency

  • Small RNA sequencing to identify potential post-transcriptional regulation

Table 4: Genomic Features of sohB in Buchnera aphidicola subsp. Schizaphis graminum

FeatureDescriptionMethodological Approach
Gene locusBUsg_272Genome sequencing and annotation
Chromosomal contextPrecise position between specific genesComparative genomics across strains
Promoter elementsTranscription factor binding sitesMotif analysis, 5' RACE, ChIP-seq
Selective pressureEvolutionary conservation leveldN/dS analysis, population genomics
Regulatory networksCo-regulated genesTranscriptome analysis under various conditions

The extreme genome reduction observed in Buchnera suggests that retained genes, including sohB, play critical roles. Genomic approaches can reveal how selection has shaped this gene over the course of the endosymbiotic relationship. Integration of these data with functional studies can provide a comprehensive understanding of how sohB regulation contributes to symbiosis maintenance.

What methodological challenges exist in studying sohB in the Buchnera-aphid system?

Researching sohB in the Buchnera-aphid system presents several significant methodological challenges that require innovative approaches:

Challenge 1: Inability to culture Buchnera outside the host

  • Solution approaches:

    • Development of improved artificial diet systems for maintaining aphids with manipulated Buchnera

    • Ex vivo bacteriocyte culture systems for short-term maintenance

    • Heterologous expression systems using related bacteria as hosts

    • In silico modeling based on genomic and proteomic data

Challenge 2: Limited genetic manipulation options

  • Solution approaches:

    • RNA interference through aphid feeding to indirectly target Buchnera genes

    • Exploitation of natural transformation mechanisms if present

    • Antibiotic treatments to perturb specific pathways

    • CRISPR interference (CRISPRi) adapted for the Buchnera-aphid system

Challenge 3: Complex host-symbiont interactions

  • Solution approaches:

    • Systems biology approaches integrating multi-omics data

    • Mathematical modeling of metabolic exchanges

    • Single-cell analyses to capture heterogeneity within bacteriocyte populations

    • Carefully designed controls to distinguish direct from indirect effects

Table 5: Methodological Challenges and Potential Solutions

ChallengeImpact on ResearchInnovative Solutions
Unculturable natureLimited experimental manipulationHeterologous expression, ex vivo systems
Genetic intractabilityDifficulty establishing gene functionRNA interference, small molecule inhibitors
Symbiont interdependenceConfounding effectsSystems approaches, mathematical modeling
Limited biomassChallenges in biochemical characterizationHighly sensitive detection methods, pooled samples
Specialized habitatArtificial conditions may alter functionImproved microscopy techniques, in situ approaches

Addressing these challenges requires multidisciplinary collaboration and the adaptation of cutting-edge technologies from other fields to the unique constraints of endosymbiont research.

How can structural biology approaches enhance understanding of sohB function?

Structural biology offers powerful tools for understanding sohB function, mechanisms, and potential inhibition strategies:

Experimental structure determination approaches:

  • X-ray crystallography of purified recombinant sohB

    • Requires optimization of expression, purification, and crystallization conditions

    • Co-crystallization with substrates or inhibitors provides functional insights

  • Cryo-electron microscopy (cryo-EM)

    • Particularly valuable if sohB forms larger complexes

    • Recent advances allow near-atomic resolution for smaller proteins

  • Nuclear magnetic resonance (NMR) spectroscopy

    • Provides dynamic information about protein structure in solution

    • Can reveal conformational changes upon substrate binding

Computational structural approaches:

  • Homology modeling based on related proteases

    • Templates might include E. coli protease IV or other serine proteases

    • Model validation using energy minimization and Ramachandran plot analysis

  • Molecular dynamics simulations

    • Reveal dynamic behavior and conformational flexibility

    • Can simulate substrate binding and catalytic mechanisms

  • Structure-based virtual screening

    • Identification of potential inhibitors or substrate analogs

    • Rational design of activity probes

The structural information gained from these approaches can be used to:

  • Identify the catalytic triad and substrate binding pocket

  • Design site-directed mutagenesis experiments to confirm mechanistic hypotheses

  • Develop specific inhibitors for functional studies

  • Understand how temperature affects protein stability and activity

  • Provide insights into the evolutionary adaptations of this protease in an endosymbiotic context

Structural insights into sohB could potentially reveal unique features that might be exploited for the development of specific inhibitors, which could have applications in understanding symbiosis dynamics or even aphid control strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.