Recombinant Buchnera aphidicola subsp. Schizaphis graminum Ubiquinol oxidase subunit 2 (cyoA)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cyoA; BUsg_456; Cytochrome bo(3 ubiquinol oxidase subunit 2; Cytochrome o ubiquinol oxidase subunit 2; Cytochrome o subunit 2; Oxidase bo(3 subunit 2; Ubiquinol oxidase polypeptide II; Ubiquinol oxidase subunit 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-290
Protein Length
Full Length of Mature Protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
cyoA
Target Protein Sequence
CDSILFNPHGIIAIQECSILLISFLIMLFVIIPVIFMTIYFSVKYRASNINAKYKPDWCD
SKKIEIIVWTIPISIILFLAFVTWNYSHILDPKKSIISKYKPIKIDVVSLDWRWLFIYPE
YHIATINEIMFPINRSIIFHITSNSVMNSFFIPSLGSQIYAMPGMMTTLNLMSNSPGKYK
GISSNYSGKGFSNMKFTAISVLNIKDFENWIKKAQQSPKKLNKMSIFNIISLPNENHFIE
YFSDVKKNLFYEIINQTYSKNKVFKH
Uniprot No.
Target Background
Function
Cytochrome bo(3) ubiquinol terminal oxidase is a key component of the aerobic respiratory chain in E. coli, predominantly expressed under high aeration conditions. Beyond electron transfer, it exhibits proton pump activity across the membrane, transporting 2 protons per electron.
Database Links
KEGG: bas:BUsg_456
STRING: 198804.BUsg456
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
