Recombinant Buchnera aphidicola subsp. Schizaphis graminum Uncharacterized membrane protein BUsg_132 (BUsg_132)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of BUsg_132

BUsg_132 is encoded by the BUsg_132 gene in Buchnera aphidicola subsp. Schizaphis graminum, a bacterial symbiont critical for aphid survival due to its role in nutrient biosynthesis . The protein is annotated as an uncharacterized membrane protein with homology to DedA family proteins, which are implicated in membrane stability and transport in bacteria .

Production and Purification

Recombinant BUsg_132 is synthesized in E. coli with an N-terminal His-tag for affinity purification .

Production Parameters:

ParameterDetails
Expression SystemE. coli (strain unspecified)
Purification MethodImmobilized Metal Affinity Chromatography (IMAC)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionSterile deionized water; 0.1–1.0 mg/mL with 50% glycerol for stability

Note: Repeated freeze-thaw cycles degrade the protein; aliquoting is recommended for long-term storage at -80°C .

Functional Insights and Research Context

Despite its "uncharacterized" annotation, BUsg_132 is hypothesized to contribute to membrane integrity or transport in Buchnera, analogous to DedA family proteins in other bacteria . Key findings from related studies include:

Table 1: Research Context for BUsg_132

Study FocusKey FindingsSource
Flagellar Basal BodiesBuchnera retains flagellar genes (e.g., flhC) encoding structural proteins; BUsg_132 may associate with membrane-bound complexes .
Metabolic EngineeringDeletion of flhC in ptsG-mutant E. coli improves recombinant protein yields, suggesting strategies for optimizing BUsg_132 production .
Symbiotic TransportBuchnera membrane transporters are highly reduced, making BUsg_132 a candidate for studying nutrient exchange in aphid symbiosis .

Applications in Current Research

  1. Structural Biology: Used for crystallography or cryo-EM to resolve membrane protein architectures .

  2. Functional Assays: Testing ion transport or lipid interactions in synthetic membranes .

  3. Symbiosis Studies: Investigating Buchnera-aphid metabolic interdependencies via gene knockout models .

Limitations and Future Directions

  • Functional Characterization: No direct experimental data on BUsg_132’s biochemical role exist .

  • Technical Challenges: Membrane protein solubility and stability complicate in vitro studies .

  • Omics Integration: Proteomic datasets (e.g., PXD024664 ) could identify interaction partners or regulatory pathways.

Research Priority: Heterologous expression in aphid cell lines or Buchnera mimic systems to assess native functionality .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
BUsg_132; Uncharacterized membrane protein BUsg_132
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
BUsg_132
Target Protein Sequence
MESWLTSLITQSLTFSILIVGIVSFLESLALVGLLLPGIVFMATLGTFIGNGKLPFYPSW IAGIIGCLLGDWCSYFIGLYFKNWLYSLKFLKKNCHLLDKTKSLLHKHSMITILVGRFIG PTRPLIPMVSGMLKLPLKKFILPSLLGCILWPPIYFFPGIITGITINIPPNPKNDYFKWL LLIIAILIWFGIWLTSKWWKIKKIKNKNNIHFIKRNIGWIALIILSSGIIGLILIQFHPT MIIVRKVFSTIL
Uniprot No.

Target Background

Database Links
Protein Families
DedA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is BUsg_132 and what is its biological significance?

BUsg_132 is an uncharacterized membrane protein from Buchnera aphidicola subspecies Schizaphis graminum, classified as a DedA family protein . The protein plays a potential role in the obligate symbiotic relationship between Buchnera and its aphid host. Buchnera aphidicola sustains the physiology of aphids by complementing their exclusive phloem sap diet, making membrane proteins particularly significant for mediating metabolic exchanges .

The biological significance of BUsg_132 likely relates to membrane transport functions, as Buchnera has evolved a simplified transport system with relatively few transporter types compared to free-living bacteria . Given that Buchnera has undergone significant genome reduction (only 600 kbps) during its evolution as an endosymbiont, the retention of this membrane protein suggests it serves an essential function in the symbiotic relationship .

How does BUsg_132 relate to other transporters in Buchnera aphidicola?

BUsg_132 is part of a limited repertoire of membrane transporters in Buchnera aphidicola. Transport in Buchnera is generally maintained through a few general transporters, some of which have likely lost substrate specificity during evolutionary genome reduction . The transport capabilities of different Buchnera strains have been shaped by distinct selective constraints occurring in different aphid lineages.

The following table compares transport protein families across different Buchnera strains:

Transport FamilyB. aphidicola (A. pisum)B. aphidicola (S. graminum)B. aphidicola (B. pistaciae)B. aphidicola (C. cedri)
MscSYggB:BU452YggB:BUSg_437YggB:BBp_402YggB:BCc_280
CC-HSP70DnaK:BU153DnaK:BUSg_146DnaK:BBp_142DnaK:BCc_096
Porin GBPOmpF:BU359OmpF:BUSg_347--
MFSYajR:BU466YajR:BUSg_450YajR:BBp_411-
MFSTsgA:BU535TsgA:BUSg_516YhfC:BBp_477-
Oxa1 IMPOxaA:BU015YidC:BUSg_016YidC:BBp_016YidC:BCc_007
PiTPitA:BU587PitA:BUSg_566PitA:BBp_531-

BUsg_132 is specifically found in the S. graminum strain and likely contributes to the specialized membrane transport functions required for the symbiotic relationship with its specific aphid host .

What expression systems are optimal for recombinant BUsg_132 production?

Several expression systems have been successfully used for producing recombinant BUsg_132, each with distinct advantages:

For membrane proteins like BUsg_132, expression optimization typically requires screening multiple conditions, including:

  • Induction temperature (often lowered to 16-20°C)

  • Inducer concentration

  • Expression duration

  • Inclusion of specific detergents or lipids

Research suggests that for uncharacterized membrane proteins like BUsg_132, parallel screening of multiple expression systems may be necessary to identify optimal conditions for functional protein production .

What purification techniques are most effective for isolating BUsg_132?

Effective purification of membrane proteins like BUsg_132 requires specialized approaches:

  • Membrane isolation: First isolate the membrane fraction containing BUsg_132 through differential centrifugation. This approach has been validated for Buchnera membrane proteins as demonstrated in the isolation of flagellum basal body complexes .

  • Detergent solubilization: Select appropriate detergents for membrane protein extraction. For Buchnera membrane proteins, non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are often effective .

  • Affinity chromatography: If the recombinant BUsg_132 includes an affinity tag (such as His-tag or Avi-tag biotinylation), use appropriate affinity resins. Some commercial preparations of BUsg_132 utilize Avi-tag biotinylation for purification .

  • Size exclusion chromatography: As a final polishing step to separate aggregates and obtain homogeneous protein preparations.

A validated purification protocol for Buchnera membrane proteins has been deposited to the ProteomeXchange Consortium (dataset identifier PXD024664) , which can serve as a valuable reference for researchers working with BUsg_132.

How should recombinant BUsg_132 be stored to maintain stability?

The optimal storage conditions for maintaining BUsg_132 stability are:

  • Short-term storage: Store working aliquots at 4°C for up to one week .

  • Medium-term storage: Store at -20°C in a buffer containing glycerol, which acts as a cryoprotectant .

  • Long-term storage: Store at -80°C in single-use aliquots to avoid repeated freeze-thaw cycles .

  • Buffer composition: The protein is typically stored in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein .

It is critically important to avoid repeated freezing and thawing, as this can lead to protein denaturation and aggregation, particularly for membrane proteins . Researchers should prepare small aliquots of the protein upon receipt to minimize the need for multiple freeze-thaw cycles.

What functional roles might BUsg_132 play in the Buchnera-aphid symbiotic relationship?

Based on current research on Buchnera-aphid symbiosis, BUsg_132 likely contributes to one or more of these critical functions:

  • Nutrient exchange: Buchnera membrane proteins facilitate the exchange of amino acids and other nutrients between the bacterium and host. Transcriptome analysis has revealed high expression of genes related to amino acid metabolism and transport in bacteriocytes . BUsg_132 may participate in this essential metabolic exchange process.

  • Membrane integrity: As a DedA family protein, BUsg_132 might be involved in maintaining membrane integrity under the specialized conditions within the aphid bacteriocyte .

  • Transport function: Buchnera from S. graminum possesses a three-membraned system with specific sets of transporters corresponding to various compound classes . BUsg_132 may play a role in this specialized transport system.

  • Flagellar apparatus: Despite genome reduction, Buchnera has retained genes for flagellum basal body structural proteins. These structures are highly expressed on Buchnera cells, though their relevance to symbiosis remains unclear . BUsg_132 might interact with or contribute to this flagellar complex.

The high conservation of this protein despite extensive genome reduction in Buchnera suggests it serves an essential function in the symbiotic relationship, though specific biochemical characterization remains to be completed .

How do membrane proteins like BUsg_132 contribute to host-symbiont communication?

Membrane proteins in the Buchnera-aphid system facilitate sophisticated host-symbiont communication through several mechanisms:

  • Vesicular transport: Ras-like Rab GTPase regulates vesicular transport of proteins and lipids in bacteriocytes. Since Buchnera cells are encased in a host membrane and lack key genes for phospholipid biosynthesis, this transport system likely delivers host-derived phospholipids to bacterial cells . BUsg_132 may interact with this vesicular transport system.

  • Mitochondrial coordination: Bacteriocytes show high expression of mitochondria-related transporters, suggesting coordinated metabolism between Buchnera and host mitochondria. This is particularly relevant as Buchnera lacks most genes for the tricarboxylic acid (TCA) cycle while retaining complete gene sets for glycolysis and respiratory chain . BUsg_132 might participate in this metabolic coordination.

  • Membrane system architecture: Buchnera from S. graminum maintains a three-membraned system , creating distinct compartments that regulate molecular exchange. As a membrane protein, BUsg_132 is positioned to facilitate transport across these membrane boundaries.

  • Amino acid exchange: A critical aspect of the symbiosis involves exchange of amino acids that Buchnera cannot produce, and utilization of amino acids that Buchnera can synthesize . Membrane transporters are essential for this exchange, with BUsg_132 potentially participating in this process.

Understanding these communication mechanisms is crucial for deciphering how this ancient symbiotic relationship has been maintained for millions of years.

What evolutionary patterns can be observed in BUsg_132 compared to similar proteins in other Buchnera strains?

Evolutionary analysis of BUsg_132 reveals patterns consistent with the genomic reduction observed across Buchnera strains:

  • Differential retention: Transport proteins show distinct patterns of retention across Buchnera strains from different aphid hosts. Buchnera from A. pisum and S. graminum have similar sets of transporters, while B. pistaciae has lost all outer-membrane integral proteins, and C. cedri shows an extremely poor repertoire of transporters .

  • Functional constraints: Despite extensive genome reduction, membrane proteins involved in essential transport functions show higher conservation, suggesting strong selective pressure to maintain these functions .

  • Membrane system adaptation: The evolution of membrane proteins in Buchnera correlates with changes in membrane system architecture. BUsg_132 in S. graminum exists in a three-membraned system, while other Buchnera strains show different membrane configurations .

The following table compares evolutionary characteristics across Buchnera strains:

CharacteristicB. aphidicola (S. graminum)B. aphidicola (A. pisum)B. aphidicola (B. pistaciae)B. aphidicola (C. cedri)
Membrane systemThree-membranedThree-membranedDouble membraneThree-membraned
Transport diversityModerateModerateReducedExtremely poor
ATP-driven transportPresentPresentPresentAlmost none
Outer membrane proteinsPresentPresentLostPresent

These patterns suggest that BUsg_132 has been retained in B. aphidicola (S. graminum) due to its essential role in the specific symbiotic relationship with its aphid host .

What methodological approaches are recommended for analyzing BUsg_132 function?

A comprehensive approach to analyzing BUsg_132 function should include:

  • Bioinformatic analysis: Begin with computational prediction of protein topology, potential binding sites, and functional domains. Compare sequence with characterized DedA family proteins to identify conserved functional motifs .

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Membrane protein crystallization or cryo-EM for 3D structure determination

    • NMR for dynamic structural information

  • Functional assays:

    • Reconstitution in liposomes to assess transport activity

    • Patch-clamp studies if channel/transporter function is suspected

    • Binding assays with potential substrates

    • Site-directed mutagenesis of conserved residues

  • In vivo studies:

    • Localization within bacteriocytes using immunogold labeling

    • Co-immunoprecipitation to identify interaction partners

    • Complementation studies in model organisms

  • Data integration: Utilize systems biology approaches to integrate multiple data types, including MetExplore for metabolic network analysis and PITUFO for precursor set extraction .

The analysis should follow a systematic workflow, examining transport functions through the re-annotation of transmembrane proteins coupled with exploration of metabolic networks, as successfully employed for other Buchnera membrane proteins .

How should researchers interpret contradictory results in BUsg_132 functional studies?

When encountering contradictory results in BUsg_132 functional studies, researchers should:

  • Evaluate internal validity: Assess experimental design for potential threats to internal validity, including maturation effects, session experience, and coincidental events . For BUsg_132 studies, this might involve examining:

    • Protein stability across experimental conditions

    • Expression system variations

    • Membrane environment differences

  • Apply multiple baseline design: Implement designs with phase changes that are sufficiently offset in:

    • Real time (calendar date)

    • Number of days in baseline

    • Number of sessions in baseline

  • Dimension-specific analysis: When analyzing contradictory data, evaluate results across three dimensions:

    • Temporal duration (days)

    • Session count

    • Calendar dates

  • Data pattern evaluation: Consider how patterns of results influence the interpretation:

    • Immediate vs. delayed changes after experimental intervention

    • Magnitude of observed effects

    • Consistency across experimental repetitions

  • Integrative approach: For uncharacterized membrane proteins like BUsg_132, triangulate findings using multiple methodological approaches:

ApproachStrengthsLimitationsContradiction Resolution
In silico predictionRapid, cost-effectiveLimited accuracyUse as hypothesis generation
In vitro biochemicalDirect functional measurementArtificial environmentValidate with multiple buffer conditions
Cell-based assaysMore physiological contextComplex interpretationCompare across multiple cell types
Structural studiesDirect mechanistic insightsTechnical challengesUse complementary techniques

By systematically evaluating contradictory results through these methodological lenses, researchers can develop a more nuanced understanding of BUsg_132 function .

What data analysis frameworks are optimal for studying membrane protein function in symbiotic systems?

For studying membrane proteins like BUsg_132 in symbiotic systems, researchers should implement a multi-layered data analysis framework:

  • Systems biology integration:

    • MetExplore information system extracts metabolic networks based on genomic annotations

    • BioCyc interface reconstructs corresponding pathways

    • PITUFO algorithm extracts precursor sets of compounds necessary for target metabolite production

  • Comparative genomics approaches:

    • TC-Blast analysis assesses transport-classification positioning

    • TMHMM software for predicting transmembrane regions

    • HAMAP annotation for membrane protein identification

  • Structured data analysis sequence:

    • Establish clear research goals

    • Determine appropriate analytics type (descriptive, diagnostic, predictive, or prescriptive)

    • Develop data collection plan

    • Clean and standardize data

    • Apply analytical methods

    • Visualize results

  • Specialized membrane protein analysis:

    • Analysis of membrane protein enrichment relative to other proteins in the proteome

    • Mass spectrometry for protein identification and quantification

    • Data deposition to repositories (e.g., ProteomeXchange Consortium)

  • Integrative network analysis:

    • Input/output compound analysis from metabolic networks

    • Integration of host-symbiont interactions

    • Proactive Data Container (PDC) approaches for organizing complex data structures

This multi-faceted approach allows researchers to systematically analyze membrane protein function in complex symbiotic systems, accounting for both host and symbiont contributions to the observed phenotypes.

How can researchers design experiments to definitively characterize the function of uncharacterized membrane proteins like BUsg_132?

A comprehensive experimental design strategy for definitively characterizing BUsg_132 function should incorporate:

  • Multiple baseline design methodology:

    • Establish concurrent baseline measurements across different experimental conditions

    • Implement phase changes with sufficient lag between each experimental variable

    • Ensure experimental control through prediction, contradiction, and replication

  • Heterologous expression optimization:

    • Test multiple expression systems (E. coli, yeast, baculovirus, mammalian cells)

    • Optimize expression conditions (temperature, induction, duration)

    • Include appropriate fusion tags for detection and purification

  • Functional characterization pipeline:

    • Transport assays using reconstituted proteoliposomes

    • Substrate screening with potential physiologically relevant compounds

    • Electrophysiological measurements for channel/transporter activity

    • Binding assays with potential interacting partners

  • Structural biology approaches:

    • Cryo-EM for membrane protein structure determination

    • NMR for dynamics and interaction studies

    • Computational modeling validated by experimental data

  • In vivo validation:

    • Gene knockout/complementation studies where possible

    • Localization within bacteriocytes

    • Interaction studies with host proteins

  • Data analysis framework:

    • Establish clear goals for each experiment

    • Use appropriate descriptive, diagnostic, predictive, and prescriptive analytics

    • Clean and standardize data before analysis

    • Visualize results effectively

This comprehensive approach, combining multiple experimental techniques with rigorous data analysis, provides the strongest framework for definitively characterizing previously uncharacterized membrane proteins like BUsg_132.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.