Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0092 membrane protein BUsg_126 (BUsg_126)

Shipped with Ice Packs
In Stock

Description

Genomic and Taxonomic Context

Buchnera aphidicola is a maternally transmitted endosymbiont that provides essential amino acids to aphids, compensating for dietary deficiencies in phloem sap . The Schizaphis graminum subspecies (BSg) harbors a 653,001-bp genome with 545 protein-coding genes, reflecting extreme reductive evolution .

Table 1: Comparative Genomic Features of Buchnera Strains

FeatureB. aphidicola BBpB. aphidicola BApB. aphidicola BSg
Genome Size (bp)618,379652,095653,001
G+C Content (%)25.326.326.2
Protein-Coding Genes504560545
Pseudogenes91338
Plasmid Size (bp)2,39911,41411,547

Data source: Genomic comparisons from reductive evolution studies .

Functional Hypotheses

Despite its classification as a membrane protein, BUsg_126’s exact role remains unresolved. Potential functions include:

  • Symbiotic Interaction: Participation in nutrient exchange (e.g., amino acids) between Buchnera and its aphid host, given the symbiont’s role in biosynthesizing essential nutrients .

  • Membrane Stability: Maintenance of membrane integrity in a reduced genome context, where gene loss necessitates functional redundancy .

  • Signal Transduction: Possible involvement in environmental sensing or stress response, though no homologs with known signaling domains have been identified.

Recombinant Production and Applications

BUsg_126 is produced via recombinant expression systems, typically in E. coli or insect cell lines, and purified for use in biochemical studies. Key production details include:

  • Expression Region: Full-length protein (1–110 residues) expressed with a tag (e.g., His-tag, GST) .

  • Storage: Supplied in Tris-based buffer with 50% glycerol, stored at -20°C. Repeated freeze-thaw cycles are discouraged .

  • Applications: Primarily used in ELISA assays to study antibody responses or protein-protein interactions in symbiosis research .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yajC; BUsg_126; Sec translocon accessory complex subunit YajC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
yajC
Target Protein Sequence
MSFFIKDANAAVNQALEGNSYSLIFMLVTFILIFYFMLFRPQQKKDKEHKNLMNSIAPGD EVMTTSGFLGRVKKVTENGYVLLQLNNTTEIFIKKDFIVSSLPKGTLESL
Uniprot No.

Target Background

Function

The SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a supercomplex essential for protein secretion, membrane protein insertion, and the assembly of membrane protein complexes. While the SecYEG complex is crucial for the assembly of numerous proteins and complexes, the SecDF-YajC-YidC subcomplex plays a vital role in facilitating these processes.

Database Links
Protein Families
YajC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Buchnera aphidicola and why is the BUsg_126 protein significant?

Buchnera aphidicola is the primary endosymbiont of aphids, having evolved from a free-living Gram-negative bacterial ancestor similar to modern Enterobacterales. This endosymbiotic relationship began 160-280 million years ago and has persisted through maternal transmission and cospeciation . The BUsg_126 protein, classified as a UPF0092 membrane protein, is particularly significant as it represents one of the conserved membrane proteins in an organism that has undergone extreme genome reduction. B. aphidicola possesses one of the smallest and most genetically stable genomes of any living organism due to gene deletion resulting from its long symbiotic relationship with aphids .

What are the structural properties of the BUsg_126 membrane protein?

The BUsg_126 protein consists of 110 amino acids with the sequence: MSFFIK DANAA VNQAL EGNSY SLIFM LVTFI LIFYFMLFRP QQKKD KEHKN LMNSI APGDE VMTTS GFLGR VKKVT ENGYV LLQLN NTTEI FIKKD FIVSS LPKGT LESL . As a membrane protein, it contains hydrophobic regions that facilitate its integration into the bacterial membrane. Unlike most Gram-negative bacteria, B. aphidicola lacks genes to produce lipopolysaccharides for its outer membrane, which may influence the structural environment in which BUsg_126 functions .

How is the recombinant BUsg_126 protein typically stored and handled?

The recombinant protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for protein stability. For storage, it is recommended to keep the protein at -20°C, or at -80°C for extended storage periods. Working aliquots can be maintained at 4°C for up to one week. Repeated freezing and thawing cycles should be avoided to prevent protein degradation and loss of functionality . When preparing experimental aliquots, it is advisable to use sterile conditions and to add protease inhibitors if the protein will be used in assays sensitive to proteolytic degradation.

What expression systems are most effective for producing recombinant BUsg_126?

For optimal results, induction conditions should be carefully controlled, typically using lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) to promote proper folding of the membrane protein .

How can researchers effectively analyze BUsg_126 interactions with host proteins in the aphid-Buchnera symbiosis?

Analyzing BUsg_126 interactions with host proteins requires a multi-faceted approach that addresses the challenges of studying an obligate endosymbiont. Effective methodologies include:

  • Co-immunoprecipitation (Co-IP) assays using antibodies specific to BUsg_126, followed by mass spectrometry to identify interacting partners

  • Yeast two-hybrid screening using BUsg_126 as bait against aphid cDNA libraries

  • Proximity-dependent biotin identification (BioID) approaches, where BUsg_126 is fused to a biotin ligase to label proximal proteins in vivo

  • Surface plasmon resonance (SPR) to measure binding kinetics between purified BUsg_126 and candidate aphid proteins

When interpreting interaction data, researchers should consider that the extreme genome reduction in B. aphidicola has resulted in loss of many regulatory pathways, potentially altering protein-protein interaction networks compared to free-living bacteria .

What techniques can distinguish BUsg_126 function from other membrane proteins in B. aphidicola?

Distinguishing the specific functions of BUsg_126 from other membrane proteins requires complementary approaches:

  • Gene expression analysis using qRT-PCR to evaluate expression patterns under various conditions, similar to methods used for studying metE gene responses to nutritional changes in B. aphidicola

  • Targeted mutagenesis through heterologous expression systems, given the difficulties of direct genetic manipulation in obligate endosymbionts

  • Comparative genomic analysis across different B. aphidicola strains to identify conserved regions and potential functional domains

  • Protein localization studies using fluorescent fusion proteins or immunogold electron microscopy to determine precise subcellular localization within the bacterial cell and the bacteriocyte

These approaches should be interpreted in the context of B. aphidicola's evolutionary history, which has led to continuous overproduction of certain amino acids and the loss of many regulatory factors .

How can researchers assess the membrane integration and topology of BUsg_126?

Determining the membrane topology of BUsg_126 is essential for understanding its function. Recommended methodological approaches include:

  • Protease protection assays: Treating intact bacterial cells or membrane vesicles with proteases to determine which protein regions are accessible

  • Cysteine scanning mutagenesis: Introducing cysteine residues at various positions and testing their accessibility to membrane-impermeable sulfhydryl reagents

  • PhoA/LacZ fusion analysis: Creating fusion proteins with reporters that function differently depending on their cellular localization

  • Cryo-electron microscopy: For high-resolution structural analysis when sufficient purified protein is available

The predicted membrane topology can be validated using computational algorithms that analyze the hydrophobicity profile of the amino acid sequence MSFFIK DANAA VNQAL EGNSY SLIFM LVTFI LIFYFMLFRP QQKKD KEHKN LMNSI APGDE VMTTS GFLGR VKKVT ENGYV LLQLN NTTEI FIKKD FIVSS LPKGT LESL, identifying potential transmembrane domains and their orientation .

What methods are most reliable for studying BUsg_126 in the context of the aphid bacteriocyte?

Studying BUsg_126 within the natural context of aphid bacteriocytes presents unique challenges due to the specialized nature of this symbiotic environment. Effective approaches include:

  • Fluorescence in situ hybridization (FISH) combined with immunofluorescence to simultaneously visualize B. aphidicola cells and BUsg_126 protein within bacteriocytes

  • Laser capture microdissection of bacteriocytes followed by RNA-seq or proteomics analysis

  • Ex vivo culture systems for short-term maintenance of isolated bacteriocytes

  • Whole-mount confocal microscopy of aphid embryos to study BUsg_126 expression during development of the symbiosis

These methods should account for the specialized structure of the aphid bacteriome, which contains sixty to eighty bacteriocyte cells housing B. aphidicola, with each mature aphid carrying approximately 5.6 × 10^6 Buchnera cells .

How can researchers effectively measure BUsg_126 expression changes in response to environmental factors?

Measuring BUsg_126 expression changes requires sensitive techniques that can detect variations in transcription and translation within the context of the endosymbiotic relationship:

  • Quantitative RT-PCR: Using primers specifically designed for BUsg_126 (similar to those used for metE in previous studies) to quantify transcript levels under different conditions

  • RNA-seq analysis: For genome-wide transcriptional profiling to place BUsg_126 expression in the context of global responses

  • Western blotting: Using custom antibodies against BUsg_126 to detect protein-level changes

  • Ribosome profiling: To assess translational efficiency under different conditions

When designing such experiments, researchers should consider the following variables and controls:

Experimental VariableMeasurement TechniqueControl ConditionReference Genes
Dietary changesqRT-PCR, RNA-seqStandard dietrpsL, 16S rRNA
Temperature fluctuationsqRT-PCR, Western blot20°C constantHeat shock proteins
Host developmental stageIn situ hybridizationAdult aphidsDevelopmentally stable proteins
Bacterial densityFlow cytometry, qPCRMid-log phase cultureGenomic DNA

The experimental design should account for the confined life cycle of B. aphidicola within the aphid bacteriome and potential effects of maternal transmission on expression patterns .

How should researchers address the challenges of studying proteins from organisms with extreme genome reduction?

Studying proteins from organisms with extreme genome reduction like B. aphidicola requires specialized analytical approaches:

  • Comparative genomics: Analyze orthologous proteins in related free-living bacteria to infer potential functions

  • Transcriptional context analysis: Examine gene neighborhood and operonic structure, considering that genome reduction has eliminated many regulatory elements

  • Evolutionary rate analysis: Compare evolutionary rates of BUsg_126 across different B. aphidicola strains to identify functionally important residues under purifying selection

  • Metabolic modeling: Use flux balance analysis to predict the role of BUsg_126 in the context of B. aphidicola's reduced metabolic network

When interpreting results, consider that B. aphidicola has lost regulatory factors, leading to continuous overproduction of certain amino acids and other metabolites, which may influence the functional context of membrane proteins .

What bioinformatic tools are most appropriate for predicting BUsg_126 function?

Given the limited experimental data available for BUsg_126, computational predictions can provide valuable insights:

  • Structural prediction algorithms: Tools like AlphaFold2 can generate tertiary structure models, especially valuable for membrane proteins where experimental structures are challenging to obtain

  • Protein domain recognition: Programs like InterProScan to identify conserved domains that might suggest function

  • Homology detection: Sensitive sequence comparison tools like HHpred or HMMER to identify distant homologs with known functions

  • Molecular dynamics simulations: To model protein-membrane interactions and potential conformational changes

These predictions should be validated experimentally whenever possible, using the protein's sequence (MSFFIK DANAA VNQAL EGNSY SLIFM LVTFI LIFYFMLFRP QQKKD KEHKN LMNSI APGDE VMTTS GFLGR VKKVT ENGYV LLQLN NTTEI FIKKD FIVSS LPKGT LESL) as the starting point for computational analysis .

How can researchers resolve contradictory results when studying BUsg_126 across different experimental systems?

Resolving contradictory results requires systematic analysis of potential sources of variation:

  • Protein preparation differences: Compare purification methods, tag positions, and buffer compositions that may affect protein conformation and activity

  • Host strain variations: Consider genetic differences between B. aphidicola strains from different aphid species, such as those from S. graminum versus A. pisum

  • Experimental conditions: Standardize temperature, pH, ionic strength, and other parameters across studies

  • Methodological sensitivity: Establish detection limits and dynamic ranges for each assay

  • Statistical analysis: Use meta-analysis approaches to integrate data from multiple studies

When contradictory results persist, design critical experiments specifically to test alternative hypotheses, keeping in mind the challenging nature of studying an obligate endosymbiont with extreme genome reduction .

What technological advances would most benefit BUsg_126 research?

Several technological advances could significantly enhance BUsg_126 research:

  • Improved genetic manipulation systems for obligate endosymbionts: Development of tools to directly modify B. aphidicola genes within the aphid host

  • Advanced imaging techniques: Higher resolution in situ visualization of protein localization within bacteriocytes

  • Single-cell proteomics: Methods for analyzing protein expression in individual Buchnera cells

  • Artificial symbiosis models: Development of simplified systems that recreate aspects of the aphid-Buchnera relationship in vitro

These advances would help overcome the current limitations in studying membrane proteins in obligate endosymbionts with extremely reduced genomes .

How might BUsg_126 research inform broader questions about endosymbiont evolution and function?

Research on BUsg_126 can provide insights into several fundamental questions:

  • Genome reduction processes: Understanding how membrane proteins evolve and maintain functionality despite massive genome streamlining

  • Host-symbiont communication: Elucidating mechanisms by which endosymbionts coordinate with host physiology

  • Metabolite transport systems: Determining how essential nutrients are exchanged across bacterial membranes in specialized symbiotic relationships

  • Evolutionary adaptation: Identifying how proteins like BUsg_126 may have changed function during the transition from free-living to endosymbiotic lifestyle

These broader implications connect BUsg_126 research to fundamental questions in evolutionary biology, symbiosis research, and microbial ecology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.