Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0114 protein in repA1-repA2 intergenic region (BUsg_PL2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. To ensure a specific tag, please inform us during your order placement, and we will prioritize its implementation.
Synonyms
BUsg_PL2; UPF0114 protein in repA1-repA2 intergenic region
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
BUsg_PL2
Target Protein Sequence
MEKIIEKSIYASRWLMFPVYVGLSFGFILLTLKFFQQIIFIIPDILAMSESGLVLAVLSL IDIALVGGLLVMVMFSGYENFISKMDIQDNEKRLGWMGTMDVNSIKNKVASSIVAISSVH LLRLFMEAERILDNKIMLCVIIRLTFVLSAFGMAYIDKMSKKKDNLH
Uniprot No.

Target Background

Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and what is its ecological significance?

Buchnera aphidicola is an obligate endosymbiont that resides within specialized cells called bacteriocytes in aphids. This bacterium has a mutualistic relationship with its aphid host, providing essential amino acids that are absent in the phloem sap diet of aphids. The relationship is obligate, meaning neither organism can survive without the other. Buchnera aphidicola subsp. Schizaphis graminum specifically refers to the Buchnera strain found in Schizaphis graminum aphids (commonly known as greenbug), which primarily feed on grasses and cereals .

The ecological significance of this relationship extends to agricultural systems, as understanding these symbiotic interactions can provide insights into aphid biology, host plant preferences, and potentially inform pest management strategies. Research indicates that host plant species significantly affects Buchnera population sizes within aphids, which may influence aphid fitness and adaptation to different host plants .

What methods are used to confirm the presence of Buchnera in aphid samples?

Confirmation of Buchnera presence in aphid samples typically involves molecular techniques targeting Buchnera-specific genes. According to the research protocols, PCR amplification of the 16S rRNA gene and the dnaK gene are commonly used to verify Buchnera presence. Researchers employ specific primers such as Buch16S1F/Buch16S1R for 16S rRNA and DnaK-F/DnaK-R for the dnaK gene, with annealing temperatures of 60°C and 58°C respectively .

When validating experimental samples, it's recommended to use the ef1α gene from the cotton-melon aphid as a negative control to ensure specificity of the amplification. After PCR confirmation that bacteriocytes contain Buchnera, researchers typically assess bacteriocyte density as a proxy for Buchnera population size. For quantitative analysis, qPCR methods comparing the ratio of Buchnera genes to host genes provide reliable estimates of symbiont population density .

How does the host plant affect Buchnera population size in aphids?

Host plants exert significant influence on Buchnera population size within aphids. Experimental evidence indicates substantial variation in Buchnera density depending on the host plant species. For instance, studies have shown that aphids reared on hibiscus and zucchini host plants exhibited significantly higher Buchnera population sizes compared to those reared on cotton and cucumber (F3,12 = 18.40, P < 0.0001) .

The mechanisms behind this variation likely involve plant secondary metabolites and nutritional profiles that differ among host plants. These factors may directly influence symbiont replication rates or indirectly affect symbiont populations through host physiological responses. When designing experiments to assess host plant effects, it's crucial to control for aphid genotype and other variables that might confound results. Researchers typically use both microscopic examination of bacteriocytes and molecular quantification methods to measure these differences in population size .

What is the function of the UPF0114 protein in the repA1-repA2 intergenic region?

The UPF0114 protein encoded in the repA1-repA2 intergenic region (BUsg_PL2) of Buchnera aphidicola is part of a family of uncharacterized proteins (hence the "UPF" designation - Uncharacterized Protein Family). While its specific function remains under investigation, its location in the intergenic region between repA1 and repA2 genes suggests potential involvement in DNA replication processes, as RepA proteins typically function in plasmid replication.

Given the reduced genome of Buchnera and the selective retention of genes essential for symbiotic function during evolutionary genome reduction, the preservation of this gene indicates it likely plays an important role in Buchnera biology. Current research approaches to characterizing such proteins include recombinant expression systems, which allow production of sufficient quantities for structural and functional studies . Structural analysis, protein-protein interaction studies, and comparative genomics across Buchnera subspecies can provide insights into this protein's role in the Buchnera-aphid symbiosis.

What experimental design considerations are critical when studying host plant effects on Buchnera populations?

When designing experiments to investigate host plant effects on Buchnera populations, researchers must carefully consider potential confounding variables that could compromise data interpretation. One critical consideration is avoiding confounding between the primary variable of interest (host plant) and other experimental factors such as aphid genotype, aphid age, or processing batches .

A robust experimental design should include:

  • Proper randomization of samples across treatment groups and processing batches to prevent systematic bias

  • Blocking designs that account for known sources of variation

  • Adequate replication at the level of the appropriate experimental unit

  • Controls for aphid genotype effects through use of isogenic lines or inclusion of genotype as a factorial variable

For example, a two-way factorial design examining both host plant and aphid genotype effects would be appropriate, as studies have demonstrated significant interaction effects between these factors (F = 14.31, P < 0.0001) . Additionally, researchers should distinguish between biological units (individual aphids), experimental units (groups independently assigned to treatments), and observational units (the entity at which measurements are made) to avoid pseudoreplication .

Batch effects can be addressed through proper experimental design and statistical approaches such as including batch as a covariate in statistical models or using methods like ComBat for batch effect adjustment in high-throughput data .

How can researchers accurately quantify Buchnera populations in aphid samples?

Accurate quantification of Buchnera populations in aphid samples requires consideration of both methodology precision and biological variability. Two primary approaches have demonstrated reliability: microscopic examination of bacteriocytes and molecular quantification through qPCR.

For microscopic examination, researchers dissect bacteriocytes from aphids and verify Buchnera presence through PCR amplification of Buchnera-specific genes. Bacteriocyte density can then be used as a proxy for Buchnera population size. This approach provides visual confirmation but may be labor-intensive for large sample sets .

For molecular quantification, quantitative PCR comparing the ratio of Buchnera genes to host genes offers a scalable approach. This method requires:

  • Careful DNA extraction protocols to ensure consistent yield and quality

  • Selection of appropriate target genes with stable copy numbers

  • Rigorous standard curve development and technical replication

  • Normalization strategies to account for differences in extraction efficiency

The correspondence between bacteriocyte counts and qPCR results has been validated (t = 5.36, df = 6, P = 0.0017), confirming qPCR as a reliable method for assessing Buchnera population size . When designing qPCR experiments, researchers should include technical replicates and appropriate controls, including no-template controls and standard curves for absolute quantification when needed.

What statistical approaches are appropriate for analyzing factorial experiments with Buchnera population data?

Analysis of Buchnera population data from factorial experiments requires careful selection of statistical approaches that address the experimental design and data characteristics. When analyzing experiments with multiple factors such as host plant and aphid genotype effects on Buchnera populations, multi-way ANOVA is generally appropriate .

The analysis should:

  • Test for main effects of each experimental factor

  • Examine interaction effects between factors

  • Use post-hoc tests (such as Tukey's test) for multiple comparisons when main effects are significant

  • Consider both statistical significance and effect size when interpreting results

For example, in a study examining host plant and aphid genotype effects on Buchnera population size, two-way ANOVA revealed that population size was significantly affected by host plant (P < 0.0001) but not by genotype alone (P = 0.1127), with a significant interaction between these factors (P < 0.0001) , as shown in the table below:

Source of variationdfMean squareFP
Host plant2691.3722.81<0.0001
Aphid genotype364.732.140.1127
Host plant × aphid genotype6433.6614.31<0.0001

When sample sizes are small, researchers should verify that their data meet ANOVA assumptions or consider non-parametric alternatives. For more complex experimental designs with nested factors or repeated measures, mixed-effects models may be more appropriate. Regardless of the approach, it's critical to account for all sources of variation in the experimental design to avoid confounding effects and misinterpretation of results .

How do plant secondary metabolites affect Buchnera populations, and what are appropriate experimental approaches?

Plant secondary metabolites significantly influence Buchnera populations within aphids, often in ways that reflect the co-evolutionary relationship between aphids, their symbionts, and host plants. To study these effects, researchers typically employ one of two experimental approaches: direct feeding assays with plant extracts or artificial diet systems supplemented with isolated metabolites .

For extract-based studies, researchers prepare extracts from different host plants through:

  • Collection and homogenization of plant material

  • Solvent extraction (typically using ethanol)

  • Concentration using rotary evaporation

  • Serial dilution to create concentration gradients (e.g., 0%, 25%, 50%, 100%)

These extracts are then incorporated into artificial diet systems using the sachet method, where diets are placed between layers of Parafilm that aphids can pierce with their stylets. After a defined feeding period (typically 3-5 days), researchers collect aphids to assess Buchnera population size using qPCR or bacteriocyte counting methods .

For studies with isolated metabolites, researchers add known concentrations of specific compounds to artificial diets. This approach allows for dose-response analysis and determination of which specific metabolites affect symbiont populations. Control treatments should include vehicle-only additions (e.g., ethanol without extract) to account for solvent effects .

Key considerations include:

  • Ensuring aphid survival differs between treatments (some extracts may cause high mortality)

  • Standardizing aphid age and physiological state before treatments

  • Monitoring food intake to distinguish between direct metabolite effects and feeding deterrence

  • Including appropriate controls for each aphid genotype, as responses may vary genetically

What approaches can be used to express and purify recombinant Buchnera proteins for functional studies?

Expression and purification of recombinant Buchnera proteins, including the UPF0114 protein from the repA1-repA2 intergenic region, present unique challenges due to the evolutionary specialization of these proteins for an intracellular symbiotic lifestyle. Effective approaches typically involve heterologous expression systems optimized for potentially challenging proteins.

A recommended workflow includes:

  • Gene synthesis and optimization: Since direct extraction of genetic material from Buchnera can be challenging, commercial gene synthesis with codon optimization for the expression host is often preferred. The sequence should be based on published Buchnera aphidicola subsp. Schizaphis graminum genome data.

  • Expression system selection: While E. coli is commonly used for bacterial protein expression, alternative systems may be considered if initial attempts fail:

    • E. coli strains specialized for problematic proteins (e.g., Rosetta for rare codons, Origami for disulfide bonds)

    • Insect cell expression systems (which may provide a more compatible environment for proteins from insect symbionts)

    • Cell-free expression systems for particularly toxic or insoluble proteins

  • Expression vector design: Incorporate:

    • Affinity tags (His, GST, or MBP) to facilitate purification

    • Solubility-enhancing fusion partners if needed

    • Inducible promoters for controlled expression

    • Appropriate signal sequences if the protein is secreted

  • Optimization of expression conditions:

    • Test multiple induction temperatures (typically lower temperatures for improved folding)

    • Vary inducer concentrations and induction times

    • Screen different media formulations

  • Purification strategy:

    • Affinity chromatography as the initial capture step

    • Secondary purification methods (ion exchange, size exclusion)

    • On-column or solution-based tag removal if necessary

  • Protein characterization:

    • Verify identity by mass spectrometry

    • Assess purity by SDS-PAGE

    • Confirm proper folding through circular dichroism or activity assays

For the UPF0114 protein specifically, researchers should consider its potential functional characteristics when designing expression and purification protocols. If it is involved in DNA binding (as suggested by its location in the repA1-repA2 intergenic region), DNA contamination during purification should be monitored and addressed .

How can batch effects be minimized when analyzing Buchnera-aphid interactions across multiple experiments?

Batch effects represent a significant challenge in multi-experiment studies of Buchnera-aphid interactions, potentially confounding biological signals with technical variation. These effects can arise from various sources including different operators, reagent lots, experimental days, or equipment calibrations. Implementing a comprehensive strategy to minimize and account for batch effects is essential .

Preventive approaches include:

  • Experimental design optimization:

    • Process all samples in a single batch when feasible

    • When multiple batches are necessary, ensure treatments are balanced across batches

    • Implement blocking designs where blocks contain complete sets of treatments

    • Include technical and biological replicates across batches to assess batch-to-batch variation

  • Randomization strategies:

    • Randomly assign samples to processing order within batches

    • Randomize plate positions for high-throughput assays

    • Use balanced randomization to ensure equal representation of conditions across batches

When batch effects cannot be entirely eliminated through design, statistical approaches can be employed:

  • Inclusion of batch as a covariate in statistical models, explicitly accounting for its effects when testing hypotheses about treatment effects

  • Batch effect adjustment methods such as:

    • ComBat, which uses an empirical Bayes framework to adjust for known batch effects

    • Mean-centering approaches that normalize data within batches

    • Surrogate variable analysis for cases where batch factors are unknown

Importantly, batch effect adjustment must be performed carefully to avoid removing biological signal along with technical noise, particularly when batch and treatment variables are partially confounded. Visualization techniques such as principal component analysis can help identify batch effects and assess the effectiveness of adjustment methods .

What sample size requirements should researchers consider when designing Buchnera population studies?

Determining appropriate sample sizes for Buchnera population studies requires balancing statistical power considerations with practical constraints. Sample size requirements vary depending on the specific research question, expected effect sizes, and inherent variability in the experimental system .

Key considerations include:

  • Effect size estimation: Pilot studies or literature reviews can provide estimates of expected differences in Buchnera populations between treatment groups. Larger sample sizes are required to detect smaller effects with statistical confidence.

  • Variability assessment: Sources of variability include:

    • Biological variation between individual aphids

    • Technical variation in measurement methods

    • Variation due to aphid genotype and age

    • Host plant effects

  • Power analysis: Formal power analysis should be conducted using estimated effect sizes and variability to determine minimum sample sizes needed to achieve desired statistical power (typically 0.8 or higher).

  • False discovery rate (FDR) control: When conducting multiple comparisons (e.g., across multiple genes or conditions), sample size requirements increase to maintain acceptable FDR levels. Studies with only 2 replicates per condition typically show high FDR, while 5-10 replicates substantially improve FDR control .

  • Reproducibility considerations: Larger sample sizes improve the consistency of results across independent experiments. Studies with 10 replicates per condition show substantially higher similarity in results compared to studies with only 2 replicates .

Practical recommendations include:

  • For preliminary studies exploring large effects: 3-5 biological replicates per condition

  • For definitive studies or when examining subtle effects: 8-10 biological replicates

  • For each biological replicate, include 2-3 technical replicates when using methods like qPCR

These guidelines should be adjusted based on the specific experimental context and the importance of detecting small effects with high confidence.

How can researchers distinguish between aphid genotype effects and host plant effects on Buchnera populations?

Distinguishing between aphid genotype effects and host plant effects on Buchnera populations requires careful experimental design that separates these potentially confounded variables. Research has shown significant interaction effects between host plant and aphid genotype (F = 14.31, P < 0.0001), highlighting the importance of this distinction .

A recommended factorial design approach includes:

  • Genotype isolation and verification:

    • Establish clonal aphid lines of distinct genotypes through single-aphid isolation

    • Verify genotype through molecular markers or microsatellite analysis

    • Maintain isogenic lines on standard host plants to minimize pre-experimental host effects

  • Factorial experimental design:

    • Use a full factorial design with multiple aphid genotypes and host plant species

    • Transfer aphids from each genotype to each host plant species

    • Include sufficient biological replication (typically 5-8 replicates per genotype-host combination)

  • Controlled environmental conditions:

    • Maintain consistent temperature, humidity, and photoperiod across all treatments

    • Standardize plant growth conditions and plant age

    • Control for position effects in growth chambers through randomization

  • Appropriate statistical analysis:

    • Analyze data using two-way ANOVA with genotype and host plant as fixed factors

    • Include interaction terms to test for genotype-by-host plant interactions

    • Use post-hoc tests (e.g., Tukey's HSD) to identify specific differences between groups

  • Longitudinal assessment:

    • Consider measuring Buchnera populations at multiple time points to distinguish between immediate responses and long-term adaptations

    • Track multiple generations when possible to identify transgenerational effects

By implementing this approach, researchers can statistically partition the variance in Buchnera population size attributable to host plant effects, aphid genotype effects, and their interaction. This distinction is critical for understanding the ecological and evolutionary dynamics of the aphid-Buchnera symbiosis across different agricultural and natural environments .

What are best practices for avoiding pseudoreplication in Buchnera-aphid interaction studies?

Pseudoreplication, the artificial inflation of sample size that occurs when the biological unit of interest differs from the experimental or observational unit, is a common pitfall in Buchnera-aphid interaction studies. Addressing this issue requires careful consideration of hierarchical experimental structure and appropriate statistical analysis .

To avoid pseudoreplication, researchers should:

  • Clearly define experimental units:

    • Distinguish between biological units (individual aphids), experimental units (independently treated entities), and observational units (where measurements are taken)

    • When entire aphid colonies are subjected to treatments, the colony is the experimental unit, not individual aphids within the colony

  • Design experiments with true replication:

    • Ensure treatments are applied to multiple independent experimental units

    • For example, if testing host plant effects, use multiple plants of each species rather than multiple leaves from the same plant

    • When using artificial diets, prepare independent batches of diet for each replicate

  • Account for nested structures:

    • Use hierarchical sampling designs that recognize natural clustering of data

    • For example, when sampling multiple aphids from the same colony or plant, use nested statistical models

    • Consider mixed-effects models that include random effects for clustering factors

  • Apply appropriate statistical analysis:

    • Use the correct error term based on the experimental unit level

    • When multiple measurements come from the same experimental unit, average these values or use them as technical replicates in the statistical model

    • For repeated measures designs, use appropriate time-series statistical approaches

  • Report sample sizes accurately:

    • Explicitly state the number of biological replicates and technical replicates

    • Clarify the level at which treatments were applied

    • Document the degrees of freedom used in statistical tests to ensure they match the true replication level

By implementing these practices, researchers can avoid inflated Type I error rates that result from pseudoreplication while maximizing the information gained from experimental resources .

What analytical methods are appropriate for investigating the effects of plant secondary metabolites on Buchnera gene expression?

Investigating how plant secondary metabolites affect Buchnera gene expression requires specialized analytical approaches that account for the unique biology of this obligate endosymbiont and its intimate relationship with the aphid host. A comprehensive analytical framework should incorporate:

  • Metabolite extraction and characterization:

    • Extract and quantify plant secondary metabolites using LC-MS/MS or GC-MS

    • Develop targeted assays for known compounds of interest

    • Use untargeted metabolomics to identify novel compounds

    • Create standardized metabolite preparations at physiologically relevant concentrations

  • Exposure systems:

    • Administer metabolites through artificial diet systems with controlled concentrations

    • Monitor aphid feeding rates to account for potential deterrent effects

    • Consider direct injection methods for precise dosing

    • Include time-course sampling to distinguish acute from chronic responses

  • RNA extraction and quality control:

    • Develop protocols for selective extraction of Buchnera RNA from aphid tissues

    • Implement rigorous quality control using bioanalyzer profiles

    • Remove host RNA contamination through selective depletion or bioinformatic filtering

    • Consider enrichment methods for bacterial transcripts

  • Transcriptomic analysis approaches:

    • RNA-Seq for genome-wide expression profiling

    • qRT-PCR for targeted analysis of specific pathways

    • Design Buchnera-specific primers that avoid cross-amplification with aphid sequences

    • Include appropriate reference genes validated for stability under experimental conditions

  • Bioinformatic analysis pipeline:

    • Use appropriate statistical models that account for the experimental design

    • Implement batch effect correction methods when necessary

    • Apply multiple testing correction for genome-wide analyses

    • Consider the reduced genome of Buchnera when interpreting pathway analysis results

  • Validation and functional studies:

    • Confirm key findings with independent experimental approaches

    • Correlate gene expression changes with physiological measurements

    • When possible, use recombinant protein approaches to test specific hypotheses about protein-metabolite interactions

This integrated approach allows researchers to establish causal relationships between plant metabolites and Buchnera gene expression changes, providing insights into how these obligate symbionts and their aphid hosts adapt to different plant chemical environments .

What are the future research directions for understanding the role of UPF0114 proteins in Buchnera-aphid symbiosis?

Understanding the role of UPF0114 proteins in Buchnera-aphid symbiosis represents an important frontier in endosymbiont biology. Several promising research directions can advance our understanding of these uncharacterized proteins and their significance in the symbiotic relationship.

First, structural biology approaches including X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy of recombinantly expressed UPF0114 proteins could reveal structural features that suggest functional roles. Comparative structural analysis with proteins of known function might identify conserved domains or motifs that provide functional insights .

Second, interaction studies using techniques such as bacterial two-hybrid systems, pull-down assays, or cross-linking mass spectrometry could identify protein binding partners or DNA/RNA targets of UPF0114 proteins. Given its location in the repA1-repA2 intergenic region, investigating potential interactions with DNA replication machinery would be particularly valuable .

Third, genetic approaches through complementation studies in related bacterial species could test hypothesized functions. While direct genetic manipulation of Buchnera remains challenging due to its obligate intracellular lifestyle, heterologous expression systems could be used to assess functional compatibility.

Fourth, comparative genomics across Buchnera strains from different aphid species could reveal patterns of conservation or co-evolution that suggest functional importance. Analysis of selection pressures on UPF0114 protein sequences would provide insights into their evolutionary significance.

Finally, systems biology approaches integrating transcriptomics, proteomics, and metabolomics data could place UPF0114 proteins within broader functional networks, potentially revealing regulatory relationships and metabolic connections that would be difficult to identify through targeted studies alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.