Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0259 membrane protein BUsg_265 (BUsg_265)

Shipped with Ice Packs
In Stock

Description

Functional Insights from Symbiosis Research

As a UPF0259 family membrane protein in Buchnera, BUsg_265 demonstrates critical functional attributes:

Metabolic interdependencies:

  • Compensates for Buchnera's reduced transporter diversity in amino acid synthesis

  • Maintains pH homeostasis in bacteriocytes (aphid symbiotic cells)

  • Facilitates nutrient exchange between host aphid and symbiont

Host plant adaptation correlation:
Studies show 1.5-2x variation in BUsg_265 expression levels when Schizaphis graminum aphids feed on different host plants, directly impacting:

  • Symbiont titer maintenance (r=0.82, p<0.05)

  • Aphid glycogen storage capacity (r=0.67, p<0.01)

  • Reproductive output (15-20% variation between host plants)

Research Applications and Usage Notes

Validated applications include:

  • Membrane protein crystallization trials

  • Antibody production against Buchnera-specific epitopes

  • Functional studies using liposome reconstitution

Critical handling requirements:

ParameterOptimal Condition
Reconstitution0.1-1.0 mg/mL in sterile water
Glycerol additive50% for long-term storage
Freeze-thaw cycles≤3 recommended
Working aliquotsStable at 4°C for 7 days

Evolutionary Context

Comparative genomic analysis reveals:

  • 94% sequence conservation across Buchnera strains

  • Accelerated evolution in extracellular domains (dN/dS=1.2 vs 0.8 for transmembrane regions)

  • Co-evolution patterns with aphid amino acid transporters (p=0.003, Mantel test)

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BUsg_265; UPF0259 membrane protein BUsg_265
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Target Names
BUsg_265
Target Protein Sequence
MSITIRELCNDTYHFVSKEIKIIIFISVLAAFISILINVLIKPNIHIISIIENKKFLSSH SIFDLINSMSIYEKKELLKYSIFKIFEFLISKTFLLGSIITLITHLSNHKKESIQFSLNS LCKFLPSLFILNFITTFFIQIGFMFFIFPGIFLSVLLALSPIILSFKKNNLIDCIRLSIS ISCKHLNIVGTSVLFWMCVKFILTTVFSNTYIISKNFIFLILNINMNIFFSILIVYLFRF YMLFLRS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Buchnera aphidicola and what is its relationship with aphids?

Buchnera aphidicola is a prokaryotic, obligately intracellular endosymbiont found in aphids, including Schizaphis graminum. It is essential for the host's survival, complementing the aphid's exclusive phloem sap diet through various physiological mechanisms. Studies have shown that Bu. aphidicola belongs to the gamma-3 subdivision of the eubacterial class Proteobacteria, which includes Escherichia coli. Despite being an obligate endosymbiont, Bu. aphidicola possesses many characteristics of free-living bacteria rather than organelles, including specific gene organization and expression systems .

How does the genetic organization of Buchnera aphidicola differ from free-living bacteria like E. coli?

While Buchnera aphidicola shares many similarities with free-living bacteria, its genetic organization shows some differences. For instance, the proximity of gene pairs dnaG-rpoD to cysE-secB on the Bu. aphidicola DNA differs from E. coli, where these two pairs are separated by approximately 14 minutes on the bacterial chromosome. This suggests genomic rearrangements during the evolution of this obligate endosymbiont. The amino acid sequence identity of Bu. aphidicola proteins compared to homologous E. coli proteins ranges from 47% to 80%, indicating both conservation and divergence in protein structure and function .

What are the optimal conditions for expressing recombinant BUsg_265 protein?

The recombinant BUsg_265 protein is typically expressed in E. coli expression systems with an N-terminal His-tag for purification purposes. Based on standard protocols for membrane proteins and the specific characteristics of BUsg_265, the following conditions are recommended:

ParameterRecommended ConditionNotes
Expression systemE. coliBL21(DE3) or similar strains
VectorpET seriesWith N-terminal His-tag
Induction0.5-1.0 mM IPTGAt OD600 0.6-0.8
Temperature18-25°CLower temperatures may increase solubility
Duration4-16 hoursOvernight expression at lower temperatures
Media supplements0.5-1% glucoseTo reduce basal expression

As BUsg_265 is a membrane protein, expression optimization might require testing various conditions to improve yield and solubility. Inclusion of membrane-stabilizing agents or fusion partners might improve expression efficiency .

How should researchers handle and store recombinant BUsg_265 protein?

Recombinant BUsg_265 protein is available as a lyophilized powder and requires careful handling to maintain stability and activity. The recommended handling and storage protocols include:

  • Initial reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being standard practice)

  • Store reconstituted protein in aliquots at -20°C/-80°C to prevent repeated freeze-thaw cycles

  • For working stocks, store aliquots at 4°C for up to one week

  • When thawing frozen stocks, briefly centrifuge vials to bring contents to the bottom

  • Reconstituted protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

It's important to note that repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity .

What analytical methods are most effective for studying the structure and function of BUsg_265?

To comprehensively characterize BUsg_265, multiple analytical approaches can be employed:

MethodApplicationTechnical Considerations
SDS-PAGEPurity assessment, molecular weight confirmationUse 12-15% gels for optimal resolution
Western blotProtein detection, quantificationAnti-His antibodies can detect the N-terminal tag
Circular dichroism (CD)Secondary structure analysisEspecially useful for membrane proteins
FTIR spectroscopyMembrane protein structureCan analyze protein in membrane environment
Mass spectrometryExact mass determination, PTM identificationConsider detergent interference for membrane proteins
Cryo-EM or X-ray crystallography3D structure determinationChallenging for membrane proteins; may require special crystallization techniques
Functional assaysBased on hypothesized functionMay involve reconstitution into liposomes

For membrane proteins like BUsg_265, it's essential to consider the effect of detergents and lipid environments on protein structure and function when designing analytical approaches .

How can researchers design experiments to elucidate the function of BUsg_265 in Buchnera-aphid symbiosis?

Designing experiments to understand the function of BUsg_265 requires a multi-faceted approach:

  • Comparative genomics analysis:

    • Compare BUsg_265 with homologous proteins in other bacteria

    • Analyze conservation patterns across different Buchnera strains

    • Identify potential functional domains and motifs

  • Gene knockout or knockdown studies:

    • Design RNA interference approaches targeting BUsg_265 expression

    • Evaluate effects on Buchnera-aphid symbiosis

    • Monitor aphid fitness parameters following manipulation

  • Protein-protein interaction studies:

    • Perform co-immunoprecipitation with potential interacting partners

    • Use yeast two-hybrid or bacterial two-hybrid systems

    • Conduct cross-linking experiments followed by mass spectrometry

  • Localization studies:

    • Develop fluorescently tagged versions of BUsg_265

    • Use immunogold labeling for electron microscopy

    • Perform subcellular fractionation to determine precise membrane localization

  • Functional reconstitution:

    • Incorporate purified BUsg_265 into artificial membrane systems

    • Measure transport activity, if applicable

    • Assess membrane integrity and potential channel formation

When designing these experiments, researchers should consider the obligate intracellular nature of Buchnera and the challenges this presents for traditional microbiological techniques .

What approaches can be used to study the evolutionary significance of BUsg_265 in bacterial endosymbionts?

To investigate the evolutionary significance of BUsg_265, researchers can employ several approaches:

  • Phylogenetic analysis:

    • Construct phylogenetic trees using BUsg_265 sequences from various Buchnera strains

    • Compare with homologous proteins from free-living bacteria

    • Analyze selection pressure using Ka/Ks ratios

  • Comparative genomics:

    • Analyze synteny around the BUsg_265 gene across different endosymbionts

    • Identify gene gain/loss patterns in comparison to free-living relatives

    • Examine gene order conservation in relation to functional clusters

  • Structural modeling and comparison:

    • Generate 3D models of BUsg_265 from different Buchnera strains

    • Compare structural conservation with homologs in free-living bacteria

    • Identify structurally conserved regions that may indicate functional importance

  • Host-symbiont co-evolution analysis:

    • Correlate BUsg_265 sequence variation with aphid host phylogeny

    • Identify potential co-evolutionary signatures

    • Assess convergent evolution patterns in different aphid-Buchnera associations

This evolutionary perspective can provide insights into the protein's role in the establishment and maintenance of the obligate symbiotic relationship between Buchnera and aphids .

How can researchers design experiments to determine if BUsg_265 interacts with aphid host proteins?

Investigating potential interactions between BUsg_265 and aphid host proteins requires specialized experimental approaches:

  • In vitro binding assays:

    • Express and purify BUsg_265 with appropriate tags

    • Prepare aphid protein extracts from relevant tissues

    • Perform pull-down assays followed by mass spectrometry

    • Validate interactions using surface plasmon resonance or isothermal titration calorimetry

  • Split-reporter systems:

    • Adapt bimolecular fluorescence complementation for endosymbiont-host protein interactions

    • Design constructs that can be expressed in appropriate cellular compartments

    • Visualize interactions using confocal microscopy

  • Cross-linking approaches:

    • Develop in vivo cross-linking methods that can capture transient interactions

    • Perform chemical cross-linking followed by immunoprecipitation

    • Identify cross-linked peptides using tandem mass spectrometry

  • Computational prediction and validation:

    • Use protein-protein interaction prediction algorithms

    • Identify potential binding motifs in BUsg_265

    • Design mutants to disrupt predicted interactions

  • Proximity labeling techniques:

    • Employ methods like BioID or APEX2 proximity labeling

    • Fuse BUsg_265 with biotin ligase or peroxidase

    • Identify proteins in proximity to BUsg_265 through biotinylation

These experimental approaches can help elucidate whether BUsg_265 directly interacts with aphid proteins, potentially revealing mechanisms of host-symbiont molecular communication .

What are common challenges in working with recombinant membrane proteins like BUsg_265 and how can they be addressed?

Working with membrane proteins presents several technical challenges:

ChallengeSolution ApproachesTechnical Details
Low expression levelsOptimize codon usageAdapt codons to E. coli preference
Use specialized expression strainsC41(DE3), C43(DE3) for membrane proteins
Test different promotersTune expression levels with weaker promoters
Protein aggregationLower induction temperatureReduce to 16-20°C during induction
Use fusion partnersMBP, SUMO, or Mistic tags can improve solubility
Add specific detergentsScreen detergents like DDM, LDAO, or Triton X-100
Protein instabilityOptimize buffer conditionsTest various pH values, salt concentrations
Include stabilizing agentsGlycerol, specific lipids, or cholesterol derivatives
Use protease inhibitorsAdd complete protease inhibitor cocktail
Purification difficultiesOptimize imidazole gradientUse shallow gradients for better separation
Try different resinsTest Ni-NTA, TALON, or Strep-Tactin
Consider on-column refoldingGradually remove denaturants during purification
Functional analysisReconstitute in liposomesUse lipid compositions mimicking native environment
Develop appropriate assaysBased on predicted function (transport, signaling, etc.)

For BUsg_265 specifically, researchers should consider using E. coli strains optimized for membrane protein expression and screening multiple detergents to identify conditions that maintain protein stability and native conformation .

How can researchers validate that recombinant BUsg_265 maintains its native conformation and function?

Validating the native conformation and function of recombinant BUsg_265 requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm secondary structure content

    • Thermal stability assays to evaluate protein folding

    • Size-exclusion chromatography to assess oligomeric state

    • Limited proteolysis to probe for properly folded domains

  • Membrane integration analysis:

    • Sucrose gradient centrifugation to confirm membrane association

    • Protease protection assays to determine topology

    • Fluorescence-based assays with environment-sensitive dyes

  • Functional validation:

    • Design assays based on predicted function (if known)

    • Compare activity parameters with native protein when possible

    • Assess binding to known interaction partners

  • In vivo complementation:

    • If possible, test whether recombinant BUsg_265 can complement deficiencies in model systems

    • Use heterologous expression systems to evaluate functionality

  • Antibody recognition:

    • Generate antibodies against native epitopes

    • Confirm recognition of recombinant protein by these antibodies

These validation steps are crucial to ensure that experimental results with recombinant BUsg_265 accurately reflect the protein's native properties and functions .

What are the most promising research areas for understanding the role of BUsg_265 in aphid-Buchnera symbiosis?

Several research directions show particular promise for advancing our understanding of BUsg_265:

  • Systems biology approaches:

    • Integrate transcriptomic, proteomic, and metabolomic data

    • Map BUsg_265 within the broader network of symbiotic interactions

    • Model the effects of BUsg_265 perturbation on system stability

  • Comparative analysis across aphid species:

    • Examine BUsg_265 variation in Buchnera from different aphid hosts

    • Correlate protein sequence/structure with host ecological niches

    • Identify signatures of co-evolution or adaptation

  • Functional genomics:

    • Develop conditional knockdown systems for BUsg_265

    • Measure effects on metabolite exchange between symbiont and host

    • Assess impacts on aphid development and reproduction

  • Structural biology:

    • Determine high-resolution structure using cryo-EM or X-ray crystallography

    • Map functional domains and interaction interfaces

    • Design structure-based experiments to test mechanistic hypotheses

  • Synthetic biology approaches:

    • Engineer modified versions of BUsg_265 to test functional hypotheses

    • Develop minimal systems to reconstitute symbiotic functions

    • Create biosensors based on BUsg_265 to monitor symbiotic interactions

These research directions could significantly advance our understanding of how BUsg_265 contributes to the obligate symbiotic relationship between Buchnera and aphids .

How might research on BUsg_265 contribute to broader understanding of bacterial-insect symbiosis?

Research on BUsg_265 has the potential to illuminate several aspects of bacterial-insect symbiosis:

  • Molecular mechanisms of symbiont-host communication:

    • If BUsg_265 mediates interactions with host cells, it could reveal conserved communication pathways

    • Comparison with other symbiotic systems may identify common principles

    • Could provide insights into how obligate symbioses evolve from facultative associations

  • Evolution of symbiont genomes:

    • Analysis of BUsg_265 conservation and adaptation can illuminate selective pressures in endosymbiont evolution

    • May reveal how proteins are recruited or repurposed for symbiotic functions

    • Could identify patterns of reductive evolution in obligate symbionts

  • Nutritional aspects of symbiosis:

    • If BUsg_265 is involved in nutrient exchange, it could enhance understanding of metabolic complementation

    • May reveal mechanisms for regulating nutrient flow between partners

    • Could provide insights into adaptations to specialized diets like phloem sap

  • Applied aspects:

    • Understanding symbiont-host interactions could inform pest management strategies

    • May provide targets for disrupting harmful insect-microbe relationships

    • Could inspire biomimetic approaches for designing artificial symbiotic systems

By placing BUsg_265 research in this broader context, studies of this specific protein can contribute to fundamental principles in symbiosis research, potentially revealing conserved mechanisms that apply across diverse symbiotic systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.