Recombinant Bufo bufo Rhodopsin (RHO)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Bufo bufo Rhodopsin is produced through heterologous expression systems, such as HEK293 mammalian cells, to study its structure, function, and interactions in controlled environments . Like human rhodopsin, it consists of a protein component (opsin) covalently bound to the chromophore 11-cis-retinal, which isomerizes to all-trans-retinal upon light absorption, initiating phototransduction .

Key Methods:

  • Expression Systems: Typically produced in HEK293 cells for proper post-translational modifications .

  • Purification: Chromatographic techniques are used to isolate rhodopsin, ensuring high purity (>95% by SDS-PAGE) .

Functional Properties:

  • Light Sensitivity: Exhibits rapid photobleaching upon light exposure, with regeneration kinetics varying between disk regions (faster in basal disks) .

  • Stability: Mutations like G51A in human rhodopsin analogs affect thermal stability, highlighting the importance of structural studies .

Key Studies on Bufo bufo Rhodopsin:

  • Aging and Localization: No differences in absorption spectrum, dichroism, or lateral diffusion rates were observed between old (distal) and new (proximal) rhodopsin in toad rods .

  • Regeneration Dynamics: Retinal regeneration occurs faster in basal disks, suggesting regional metabolic differences in photoreceptors .

Table 2: Comparative Properties of Old vs. New Rhodopsin

PropertyOld (Distal) RhodopsinNew (Proximal) Rhodopsin
Absorption SpectrumIdenticalIdentical
Lateral Diffusion Rate0.35 µm²/s0.35 µm²/s
Regeneration RateSlowerFaster

Disease Modeling:

  • Retinitis Pigmentosa (RP): RHO mutations (e.g., P23H, T17M) disrupt folding or trafficking, leading to photoreceptor degeneration. Recombinant Bufo rhodopsin aids in studying these mechanisms .

  • Gene Therapy: RNA replacement strategies using siRNA-resistant RHO genes have shown promise in restoring rhodopsin function in transgenic models .

Pharmacological Interventions:

  • Chaperone Molecules: Compounds like YC-001 stabilize mutant rhodopsin (e.g., P23H) and enhance trafficking to photoreceptor outer segments .

Challenges and Limitations

  • Expression Yield: Low solubility of recombinant rhodopsin in heterologous systems remains a technical hurdle .

  • Mutant-Specific Variability: Not all class II mutants (e.g., P53R, C110Y) respond uniformly to pharmacological chaperones .

Future Directions

  • High-Resolution Imaging: Cryo-electron microscopy and atomic force microscopy (AFM) could refine structural models of recombinant rhodopsin arrays .

  • In Vivo Delivery: Optimizing AAV vectors for RHO gene replacement in animal models may translate to clinical therapies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RHO; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Bufo bufo (European toad)
Target Names
RHO
Target Protein Sequence
MNGTEGPNFYIPMSNKTGVVRSPFEYPQYYLAEPWQYSILCAYMFLLILLGFPINFMTLY VTIQHKKLRTPLNYILLNLAFANHFMVLCGFTVTMYSSMNGYFILGATGCYVEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFSENHAVMGVAFTWIMALSCAVPPLLGWSRYIP EGMQCSCGVDYYTLKPEVNNESFVIYMFVVHFTIPLIIIFFCYGRLVCTVKEAAAQQQES ATTQKAEKEVTRMVIIMVVFFLICWVPYASVAFFIFSNQGSEFGPIFMTVPAFFAKSSSI YNPVIYIMLNKQFRNCMITTLCCGKNPFGEDDASSAATSKTEASSVSSSQVSPA
Uniprot No.

Target Background

Function
A photoreceptor essential for low-light vision and post-natal photoreceptor cell survival. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating G-protein signaling. Subsequent receptor phosphorylation, mediated by arrestin, displaces the bound G-protein alpha subunit, terminating the signal.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Bufo bufo rhodopsin and how does it function in visual transduction?

Rhodopsin is the major protein component of rod photoreceptor outer segment (ROS) disks in the toad Bufo bufo, serving as the primary visual pigment for scotopic (low-light) vision. Functionally, rhodopsin consists of the protein opsin coupled with a light-sensitive 11-cis-retinal chromophore that undergoes photoisomerization upon light absorption. This conformational change initiates the visual transduction cascade by activating transducin, which subsequently leads to hyperpolarization of the photoreceptor cell.

Microspectrophotometric analysis reveals that Bufo rhodopsin has an absorption maximum (λmax) at approximately 505 nm, consistent with a single 11-cis-retinal-based pigment system . The protein remains stably associated with the disk membrane into which it was initially inserted throughout the lifetime of that membrane .

How is rhodopsin synthesized and distributed in Bufo photoreceptors?

In Bufo species, as in other vertebrates, rhodopsin undergoes a continuous renewal process. New rhodopsin is synthesized in the inner segment of rod photoreceptors and incorporated into newly formed disk membranes at the base (proximal end) of the rod outer segment. These disks migrate outward as newer disks form at the base, eventually reaching the distal tip where the oldest disks are shed and phagocytosed by retinal pigment epithelium cells .

This continuous renewal process creates a gradient of rhodopsin age within the rod, with the newest rhodopsin molecules located at the base and the oldest at the tip. Studies using microspectrophotometry have determined that despite differences in age, rhodopsin molecules maintain consistent properties throughout the rod outer segment .

What methods are used to measure rhodopsin concentration in Bufo photoreceptors?

Multiple complementary techniques are employed to quantify rhodopsin levels in Bufo photoreceptors:

  • Scanning densitometry of Western blots allows for relative quantification of rhodopsin protein levels compared to control samples. This method is particularly useful for comparing rhodopsin content across different experimental conditions.

  • Bleaching difference spectrophotometry measures the change in absorption before and after light exposure to determine rhodopsin concentration. This technique can be applied to whole retinal homogenates to calculate total rhodopsin content.

  • Microspectrophotometry enables measurement of rhodopsin density in individual rod outer segments by determining the optical density at the absorption maximum (λmax) divided by the outer segment diameter. For Bufo species, the specific density in wild-type rods has been measured at approximately 0.012 ± 0.022 μm^-1 .

These techniques collectively provide reliable quantification of rhodopsin content at both the cellular and tissue levels, which is essential for understanding photoreceptor biology and visual function.

What expression systems are suitable for recombinant Bufo bufo rhodopsin production?

The expression of functional recombinant Bufo bufo rhodopsin requires a system capable of proper protein folding and post-translational modifications. While not explicitly detailed in the search results, the following methodological approaches can be recommended based on similar rhodopsin expression studies:

Mammalian cell lines (particularly HEK293 and COS-1 cells) represent the most reliable expression systems for obtaining correctly folded rhodopsin with appropriate post-translational modifications. These cells can be transfected with expression vectors containing the Bufo bufo opsin gene sequence. For proper chromophore incorporation, cells must be supplied with 11-cis-retinal either during or after protein expression.

The expression vector should ideally include an affinity tag (such as a polyhistidine or 1D4 epitope tag) to facilitate purification while minimizing interference with protein folding and function. Additionally, expression can be enhanced by optimizing the signal sequence and incorporating chaperon-assisting molecules to improve membrane insertion efficiency.

What are the key considerations for purifying recombinant Bufo rhodopsin?

Purification of recombinant Bufo rhodopsin requires careful handling to maintain protein stability and functionality. The entire purification process should be conducted under dim red light conditions (>620 nm) to prevent unwanted photoactivation.

A typical methodological approach includes:

  • Cell membrane preparation: Harvested cells are disrupted by osmotic shock or mechanical methods, followed by differential centrifugation to isolate membrane fractions containing rhodopsin.

  • Solubilization: Membranes are solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin that preserve the native structure of rhodopsin.

  • Affinity chromatography: If the recombinant protein contains an affinity tag, corresponding affinity resins can be used for selective binding and purification. For example, if the construct contains a 1D4 epitope tag, 1D4 antibody-conjugated Sepharose can be used.

  • Quality control: Purified rhodopsin should be assessed for spectral properties, particularly the A280/A500 ratio, which indicates purity and proper folding. Values below 1.6 typically indicate high-quality preparations with proper chromophore incorporation.

The purification conditions, including buffer composition, pH, and salt concentration, should be optimized to maintain the stability of Bufo rhodopsin, which may have different requirements compared to mammalian rhodopsins.

How do old and new rhodopsin molecules compare in Bufo photoreceptors?

Despite the age gradient of rhodopsin in Bufo rod outer segments, detailed microspectrophotometric analyses have revealed no significant differences between old (distal) and new (proximal) rhodopsin molecules in several key properties:

  • Absorption spectrum: Both old and new rhodopsin display identical spectral characteristics with the same absorption maximum.

  • Concentration: The concentration of rhodopsin remains constant throughout the outer segment.

  • Dichroism: No differences in dichroic properties are observed between old and new rhodopsin.

  • Photoconversion rates: The rate at which rhodopsin converts to metarhodopsin upon light exposure is consistent throughout the outer segment.

  • Lateral diffusion rates: The mobility of rhodopsin molecules within the disk membrane is similar regardless of age .

These findings suggest that rhodopsin molecules maintain their structural and functional integrity throughout their lifetime in the rod outer segment, with no evidence of age-dependent protein modifications or degradation that affect these properties.

What factors influence rhodopsin regeneration kinetics in Bufo species?

Rhodopsin regeneration from the bleached state shows interesting variations in Bufo species. Studies have revealed that regeneration occurs more rapidly in the basal (newer) disks compared to the distal (older) disks in the living toad eye . This differential regeneration rate cannot be attributed to intrinsic differences in rhodopsin molecules themselves, as their properties remain consistent throughout the outer segment.

Rather, the spatial variation in regeneration rates likely stems from:

  • Point of entry of regeneration retinoids: The precursors for 11-cis-retinal may enter the rod outer segment preferentially at the base, creating a concentration gradient.

  • Access to cellular regeneration machinery: Proteins involved in the visual cycle may have differential access to different regions of the outer segment.

  • Structural differences in disk membranes: Age-dependent changes in the lipid composition or organization of disk membranes might influence the efficiency of regeneration processes.

These findings highlight the importance of considering spatial factors when studying rhodopsin regeneration kinetics in experimental systems.

How can rhodopsin concentration be experimentally manipulated, and what are the functional consequences?

Experimental manipulation of rhodopsin concentration provides valuable insights into the relationship between pigment density and photoreceptor function. The search results describe approaches using gene disruption to create animal models with reduced rhodopsin levels .

Methodologically, this can be achieved through:

  • Targeted gene disruption: Knockout or knockdown of one or both opsin alleles

  • RNA interference: Reducing opsin mRNA levels through siRNA or shRNA

  • CRISPR/Cas9 genome editing: Creating specific modifications to the opsin gene

The functional consequences of reduced rhodopsin concentration include:

  • Sensitivity changes: Rods with approximately 50% normal rhodopsin concentration (as in heterozygous opsin knockout mice) show a corresponding 50% reduction in light sensitivity .

  • Response kinetics: Interestingly, reduced rhodopsin concentration leads to accelerated flash-response kinetics, suggesting compensatory changes in phototransduction cascade regulation .

  • Protein expression changes: Cells with reduced rhodopsin may show altered expression of other phototransduction proteins, such as a 50% increase in phosducin observed in heterozygous opsin knockout mice .

These findings demonstrate that rhodopsin concentration not only affects photon capture efficiency but also influences the dynamics of the entire phototransduction pathway through complex regulatory mechanisms.

What techniques are optimal for measuring lateral diffusion of rhodopsin in disk membranes?

The lateral diffusion of rhodopsin within disk membranes represents an important biophysical property that influences photoreceptor function. The search results indicate that this parameter can be measured using photobleaching approaches in combination with microspectrophotometry .

A methodological approach for measuring lateral diffusion includes:

  • Preparation: Isolated rod outer segments are positioned in the measuring beam of a microspectrophotometer.

  • Selective photobleaching: A small region of the rod outer segment is exposed to high-intensity light to bleach rhodopsin molecules in that area.

  • Monitoring absorbance changes: The absorbance is monitored over time as unbleached rhodopsin molecules diffuse into the bleached area.

  • Data analysis: The time course of absorbance recovery is analyzed to determine the diffusion coefficient.

For control experiments, rhodopsin diffusion can be blocked by treating rods with glutaraldehyde (typically 4% for 30 minutes), which cross-links membrane proteins and prevents lateral movement . This approach allows researchers to distinguish between absorbance changes due to lateral diffusion and those resulting from other processes such as photoconversion.

It is worth noting that when studying recombinant Bufo rhodopsin in artificial membrane systems, additional techniques such as fluorescence recovery after photobleaching (FRAP) or single-particle tracking may be employed to measure lateral diffusion with greater precision.

How does rhodopsin density affect photoreceptor morphology and function?

The relationship between rhodopsin density and photoreceptor structure and function can be examined through comparison of wild-type and genetically modified systems with altered rhodopsin expression. The search results provide insights from studies of opsin knockout mice that are relevant to understanding this relationship .

Complete absence of rhodopsin (as in homozygous opsin knockout mice) has profound effects on rod photoreceptor development and survival:

  • Outer segments fail to form properly

  • Photoreceptor cells degenerate rapidly, with significant loss within 30 days and nearly complete degeneration by 90 days

In contrast, reduced rhodopsin expression (as in heterozygous opsin knockout mice with approximately 50% normal rhodopsin levels) results in:

  • Normal outer segment formation with standard dimensions

  • Reduced rhodopsin concentration within the outer segment membranes

  • Slower photoreceptor degeneration compared to complete knockout

  • Altered flash-response properties, including faster response kinetics

  • Changes in expression levels of other phototransduction proteins

These findings indicate that rhodopsin plays dual roles: as the primary visual pigment and as a structural protein essential for outer segment formation and stability. For recombinant Bufo rhodopsin studies, these relationships should be considered when interpreting the effects of expression level variations or mutations on cellular physiology.

What spectroscopic methods provide the most informative data about recombinant rhodopsin quality?

Spectroscopic analysis is critical for assessing the quality and functionality of recombinant rhodopsin preparations. Based on approaches described in the search results, several complementary methods can be recommended:

  • Absorption spectroscopy: Standard UV-visible spectrophotometry provides basic information about rhodopsin concentration and purity. Key parameters include:

    • Absorption maximum (λmax): For Bufo rhodopsin, this should be approximately 505 nm

    • A280/A505 ratio: Indicates purity and proper folding with chromophore incorporation

    • Spectral shape: Should match the characteristic profile of native rhodopsin

  • Difference spectroscopy: Measuring the spectrum before and after photobleaching provides a sensitive method for quantifying functional rhodopsin. The difference spectrum eliminates contributions from non-rhodopsin proteins and unfolded opsin.

  • Microspectrophotometry: For detailed analysis of recombinant rhodopsin reconstituted into artificial membrane systems, microspectrophotometry can measure specific properties including:

    • Specific density (absorbance per unit path length)

    • Dichroic ratio (polarization-dependent absorption)

    • Spectral fine structure

  • Circular dichroism: Provides information about the secondary structure and allows detection of misfolding that might not be apparent in absorption spectra.

The choice of spectroscopic method depends on the specific research question, with microspectrophotometry offering the highest sensitivity for detecting subtle differences in rhodopsin properties but requiring specialized equipment and expertise.

How can recombinant Bufo rhodopsin serve as a model system for studying retinal degenerative diseases?

Recombinant Bufo bufo rhodopsin can serve as a valuable model system for investigating the molecular mechanisms underlying retinal degenerative diseases, particularly those caused by rhodopsin mutations. The amphibian rhodopsin shares significant sequence homology with human rhodopsin while offering certain experimental advantages.

Methodological approaches for using recombinant Bufo rhodopsin in disease modeling include:

  • Site-directed mutagenesis: Introduction of mutations corresponding to human disease-causing variants allows examination of their effects on protein stability, folding, and function in a controlled system.

  • Expression system comparison: Parallel expression of wild-type and mutant rhodopsins provides direct comparison of expression levels, cellular localization, and spectral properties.

  • Biochemical stability assays: Testing the thermal stability and resistance to denaturation of mutant rhodopsins can reveal structural vulnerabilities that may contribute to disease pathogenesis.

The search results describe how mutations in rod opsin lead to photoreceptor cell death and retinal degeneration . Studies of genetically modified mice with altered opsin expression reveal that complete absence of rhodopsin prevents normal outer segment formation and causes rapid photoreceptor degeneration, while reduced rhodopsin levels lead to slower degeneration . These findings suggest that both loss-of-function and gain-of-function mechanisms may contribute to rhodopsin-associated retinal diseases.

By expressing specific mutations in recombinant Bufo rhodopsin and characterizing their effects, researchers can gain insights into disease mechanisms that may be applicable across species, potentially identifying targets for therapeutic intervention.

What statistical approaches are recommended for analyzing rhodopsin spectral and kinetic data?

Proper statistical analysis is essential for interpreting experimental data on rhodopsin properties. Based on the methodologies described in the search results, the following approaches are recommended:

For spectral data:

  • Replicate measurements: Multiple spectra should be collected from different preparations (n ≥ 3) to account for sample-to-sample variation.

  • Normalization: Spectra may be normalized to either peak absorbance or protein concentration to facilitate comparison across samples.

  • Curve fitting: Rhodopsin absorption spectra typically follow a template that can be fit using mathematical models to extract parameters like λmax and bandwidth.

  • Statistical comparison: Parameters extracted from spectral data should be compared using appropriate statistical tests (e.g., t-test for two-group comparisons, ANOVA for multiple groups).

For kinetic data (e.g., photobleaching, regeneration, diffusion rates):

  • Time-course analysis: Kinetic data often follow first-order or more complex kinetics. For example, the search results describe a linear first-order rate plot for rhodopsin photoconversion that remained linear over more than eight half-lives .

  • Rate constant determination: Fitting exponential functions to time-course data provides rate constants that can be compared across experimental conditions.

  • Multiple components analysis: Some processes may involve multiple kinetic components, requiring more complex models for proper analysis.

The research methods described in the search results illustrate this approach. For example, in studying photoconversion rates, researchers used a first-order rate plot to confirm that a single process (rhodopsin photoconversion) was being measured under the experimental conditions .

How should experimental controls be designed for recombinant rhodopsin studies?

Robust experimental controls are critical for ensuring the validity and reproducibility of recombinant rhodopsin studies. Based on methodologies described in the search results, the following control strategies are recommended:

  • Expression controls:

    • Empty vector controls to account for endogenous effects of the expression system

    • Wild-type rhodopsin expressed in parallel with mutant variants

    • Concentration-matched samples for comparative studies

  • Spectroscopic controls:

    • Baseline measurements before any experimental manipulation

    • Comparison of absorption spectra before and after photobleaching

    • Measurement of non-rhodopsin proteins to control for non-specific effects

  • Kinetic experiment controls:

    • Fixed (glutaraldehyde-treated) samples to prevent lateral diffusion when studying photoconversion rates

    • Dark controls to account for thermal effects or spontaneous changes

    • Temperature-matched conditions for comparative studies

  • Negative controls:

    • Samples lacking chromophore (opsin only) to distinguish between effects on the protein and effects on the visual cycle

    • Denatured protein controls for non-specific binding or spectral artifacts

The search results illustrate how these control strategies are implemented in practice. For example, when studying photoconversion rates, researchers used glutaraldehyde fixation to prevent lateral diffusion of rhodopsin, ensuring that observed absorbance changes were due solely to photoconversion . Similarly, studies of rhodopsin regeneration employed multiple approaches (in vivo, in vitro, and in eyecups) to control for different regeneration conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.