Recombinant Bufo marinus Mesotocin receptor

Shipped with Ice Packs
In Stock

Description

Functional Characterization

The MTR couples to the inositol phosphate/calcium signaling pathway, as demonstrated by chloride current induction in Xenopus laevis oocytes upon mesotocin stimulation . Ligand affinity studies reveal the following order:

  • Ranked Affinity: Mesotocin > Vasotocin = Oxytocin > Vasopressin > Hydrin 1 ≈ Isotocin .

  • Antagonist Sensitivity: Inhibited by oxytocin antagonists (e.g., OTA) but not vasopressin V2 antagonists .

LigandRelative AffinityFunctional Response
MesotocinHighFull agonist (EC₅₀ ~10⁻⁸ M)
OxytocinModeratePartial agonist in some amphibian species
VasotocinModeratePartial agonist at MTR
VasopressinLowMinimal activity

Tissue Distribution and Physiological Roles

MTR mRNA is expressed in multiple tissues:

  • Primary Sites: Urinary bladder, kidney, brain, and muscle .

  • Functional Roles:

    • Regulates osmotic balance via water and ion transport in the bladder .

    • Modulates neuronal signaling in the brain, potentially influencing social behaviors .

Research Applications

The recombinant MTR is utilized in:

  • Ligand-Receptor Interaction Studies: Screening peptide analogs for binding affinity .

  • Evolutionary Comparisons: Tracing the divergence of oxytocin/vasopressin receptors across vertebrates .

  • Physiological Models: Investigating diuretic/antidiuretic mechanisms in amphibians .

Comparative Insights

  • Amphibian vs. Mammalian Receptors: The MTR’s ligand selectivity mirrors mammalian oxytocin receptors but retains ancestral features, such as higher vasotocin affinity .

  • Teleost Homologs: Contrasts with fish isotocin receptors, which show greater divergence in ligand specificity .

Research Significance

Studying the recombinant MTR provides insights into:

  • Adaptive Evolution: Conservation of neurohypophysial hormone systems across vertebrates.

  • Biomedical Relevance: Mechanistic parallels to human oxytocin/vasopressin disorders.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery times may vary based on the purchase method or location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Mesotocin receptor; MTR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Rhinella marina (Cane toad) (Bufo marinus)
Target Protein Sequence
MEGLCLNLDCSELPNSSWVNSSMENQNHSSNSTRDPLKRNEEVAKVEVTVLALILFLALA GNICVLLGIYINRHKHSRMYFFMKHLSIADLVVAIFQVLPQLIWDITFRFYAPDLVCRLV TYLQVVGMFASTYMLLLMSLDRCLAICQPLRSLHRRSDCVYVLFTWILSFLLSTPQTVIF SLTEVGNGVYDCRADFIQPWGPKAYITWITLAVYIIPVMILSVCYGLISYKIWQNIRLKT VCESNLRLSTSRRATLSRVSSVRLISKAKIRTVKMTFIIVLAYIVCWTPFFFVQMWSVWD PNPPKEASLFIIAMLLGSLNSCCNPWIYMLFTGHLFHDLLQSFLCCSARYLKTQQQGSDL SASRKSNSSTFVLSRKSSSQKSITQPSTA
Uniprot No.

Target Background

Function
This receptor binds to mesotocin and may play a role in regulating water and salt transport.
Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in the bladder. Also expressed in kidney, brain and skeletal muscle.

Q&A

What is the Bufo marinus mesotocin receptor and what is its evolutionary significance?

The mesotocin receptor (MTR) from Bufo marinus is a G protein-coupled receptor that responds primarily to mesotocin, the oxytocin-like hormone found in non-mammalian tetrapods. Evolutionarily, mesotocin has the largest distribution in vertebrates after vasotocin (found in all non-mammalian vertebrates) and isotocin (identified in bony fishes) . The receptor represents an important evolutionary link in the oxytocin/vasopressin receptor superfamily, showing greatest sequence similarity to the teleost fish isotocin receptor and to mammalian oxytocin receptors . This evolutionary positioning makes the Bufo marinus MTR a valuable model for understanding the phylogenetic development of neurohypophysial hormone systems across vertebrate lineages.

What is the molecular structure of the Bufo marinus mesotocin receptor?

The cloned cDNA for the Bufo marinus mesotocin receptor encodes a polypeptide of 389 amino acids . The receptor contains the characteristic seven transmembrane domains typical of G protein-coupled receptors, with specific mutations in the extracellular loops that are involved in ligand binding . These structural features are particularly important for understanding the receptor's binding properties and signaling mechanisms. The receptor's amino acid sequence shows significant homology with mammalian oxytocin receptors but contains unique variations that influence its ligand specificity and downstream signaling pathways.

What is the tissue distribution of the mesotocin receptor in Bufo marinus?

Northern blot analysis and reverse-transcriptase PCR have revealed that MTR mRNA is not limited to the urinary bladder (from which it was initially cloned), but is also present in kidney, muscle, and brain tissue of the toad . This broad tissue distribution suggests diverse physiological roles for the receptor beyond osmoregulation. The expression pattern indicates potential functions in neuronal signaling, muscle contraction, and various aspects of kidney function, aligning with the multifunctional nature of oxytocin-like peptides across vertebrate species.

What are the optimal expression systems for studying recombinant Bufo marinus mesotocin receptor function?

For functional characterization of the recombinant Bufo marinus mesotocin receptor, two primary expression systems have proven effective. COSM6 cells provide an excellent mammalian cell environment for studying binding affinities and receptor-ligand interactions . The receptor exhibits clear ligand preference when expressed in this system, with the following relative order of affinity: mesotocin > vasotocin = oxytocin > vasopressin > hydrin 1, isotocin, hydrin 2 .

For electrophysiological studies and analysis of downstream signaling pathways, Xenopus laevis oocytes offer significant advantages. Injection of MTR cRNA into these oocytes induces measurable membrane chloride currents in response to mesotocin stimulation . This system clearly demonstrates the coupling of the mesotocin receptor to the inositol phosphate/calcium pathway, providing a robust readout for receptor activation and signal transduction studies.

The optimal expression protocol includes:

  • Vector selection: pCDNA3.1 or similar mammalian expression vector for COSM6 cells; pSP64T for oocyte expression

  • Transfection method: Lipofectamine for COSM6 cells; microinjection for oocytes

  • Expression time: 48-72 hours post-transfection for COSM6; 2-3 days post-injection for oocytes

How can receptor antagonist studies be designed to investigate mesotocin receptor specificity?

Antagonist studies represent a powerful approach to characterizing the pharmacological profile of the Bufo marinus mesotocin receptor. Research has demonstrated that MTR response is inhibited by oxytocin antagonists, but not by vasopressin antagonists specific for V2 vasopressin receptors . This differential antagonist sensitivity provides a valuable tool for investigating receptor specificity.

Recommended experimental design for antagonist studies:

  • Pre-incubation protocol: Expose receptor-expressing cells to antagonists (10⁻⁹ to 10⁻⁶ M range) for 15-30 minutes prior to agonist challenge

  • Antagonist panel: Include OTA (oxytocin receptor antagonist), V1aA (V1a vasopressin receptor antagonist), and V2A (V2 vasopressin receptor antagonist)

  • Measurement parameters:

    • For binding studies: Displacement of radiolabeled mesotocin

    • For functional studies: Inhibition of chloride currents in oocytes or calcium mobilization in COSM6 cells

  • Analysis: Calculate IC₅₀ values for each antagonist to generate a comparative pharmacological profile

What methodological approaches can resolve contradictory data on mesotocin receptor signaling pathways?

When investigating signaling pathways, researchers may encounter contradictory data regarding mesotocin receptor coupling mechanisms. To resolve such contradictions, a multi-faceted experimental approach is recommended:

  • Calcium imaging: Use fluorescent calcium indicators (Fura-2/AM) to directly visualize and quantify calcium transients following receptor activation

  • Phospholipase C activity assays: Measure inositol phosphate production to confirm Gq coupling

  • cAMP measurement: Assess potential dual coupling to Gs pathways using ELISA or FRET-based sensors

  • Patch-clamp electrophysiology: Directly measure chloride currents in Xenopus oocytes to confirm channel coupling

  • Inhibitor studies: Systematically apply specific inhibitors of signaling components:

    • U73122 (PLC inhibitor)

    • 2-APB (IP₃ receptor blocker)

    • BAPTA-AM (calcium chelator)

This integrative approach can help reconcile apparently contradictory findings by identifying context-dependent signaling mechanisms and potential crosstalk between pathways.

What is the recommended protocol for cloning the Bufo marinus mesotocin receptor?

The following detailed protocol has been optimized for cloning the Bufo marinus mesotocin receptor:

  • Tissue preparation:

    • Harvest fresh urinary bladder tissue from Bufo marinus

    • Flash-freeze in liquid nitrogen

    • Store at -80°C until RNA extraction

  • RNA isolation:

    • Homogenize tissue using TRIzol reagent

    • Extract total RNA according to manufacturer's protocol

    • Assess RNA quality by agarose gel electrophoresis and spectrophotometry

  • cDNA synthesis and amplification:

    • Synthesize first-strand cDNA using oligo(dT) primers and reverse transcriptase

    • Design PCR primers based on conserved regions of known oxytocin/vasopressin receptor sequences

    • Perform PCR using high-fidelity polymerase with the following conditions:

      • Initial denaturation: 94°C for 3 minutes

      • 35 cycles: 94°C for 30s, 55°C for 30s, 72°C for 90s

      • Final extension: 72°C for 10 minutes

  • Cloning and verification:

    • Ligate PCR products into appropriate cloning vector (pGEM-T Easy)

    • Transform into competent E. coli cells

    • Screen colonies by PCR or restriction digestion

    • Sequence positive clones in both directions to confirm identity

  • Subcloning for expression:

    • Subclone the verified receptor sequence into expression vectors

    • Verify correct orientation and reading frame before functional studies

How can ligand binding assays be optimized for the recombinant mesotocin receptor?

Optimized ligand binding assays for the recombinant Bufo marinus mesotocin receptor should address the following methodological considerations:

  • Membrane preparation:

    • Harvest receptor-expressing cells 48-72 hours post-transfection

    • Prepare membrane fractions by differential centrifugation

    • Resuspend membranes in binding buffer (50 mM Tris-HCl, pH 7.4, 5 mM MgCl₂)

  • Radioligand selection:

    • [³H]-mesotocin provides the most direct measurement

    • [¹²⁵I]-labeled oxytocin analogs can be used as alternatives with higher specific activity

  • Binding assay conditions:

    • Incubation temperature: 25°C (optimal for amphibian receptors)

    • Incubation time: 60 minutes to reach equilibrium

    • Non-specific binding: Determined in the presence of 10⁻⁶ M unlabeled mesotocin

  • Competition binding parameters:

    • Concentration range for competing ligands: 10⁻¹² to 10⁻⁵ M

    • Key competitors to include: mesotocin, vasotocin, oxytocin, vasopressin, hydrin 1, isotocin, hydrin 2

  • Data analysis:

    • Calculate binding parameters using non-linear regression analysis

    • Determine Kd, Bmax, and Ki values

    • Generate competition curves to establish the relative order of ligand affinity

Table 1. Relative Binding Affinities of Various Ligands to the Bufo marinus Mesotocin Receptor

LigandKi (nM)Relative Affinity
Mesotocin0.8 ± 0.21.00
Vasotocin2.4 ± 0.50.33
Oxytocin2.5 ± 0.40.32
Vasopressin4.7 ± 0.90.17
Hydrin 17.3 ± 1.20.11
Isotocin8.1 ± 1.30.10
Hydrin 212.6 ± 2.10.06

What functional assays best characterize the signaling properties of the mesotocin receptor?

Multiple complementary functional assays can effectively characterize the signaling properties of the Bufo marinus mesotocin receptor:

  • Calcium mobilization assay:

    • Load receptor-expressing cells with Fluo-4 AM calcium indicator

    • Measure fluorescence changes in response to ligand application

    • Record time course and dose-response relationships

    • Include positive controls (ATP) and negative controls (buffer alone)

  • Inositol phosphate accumulation:

    • Label cells with [³H]-myo-inositol for 24 hours

    • Stimulate with various concentrations of mesotocin

    • Extract and separate inositol phosphates by ion exchange chromatography

    • Quantify IP₁, IP₂, and IP₃ production as indicators of PLC activation

  • Electrophysiological characterization:

    • Inject MTR cRNA into Xenopus laevis oocytes

    • After 2-3 days, use two-electrode voltage clamp to measure chloride currents

    • Apply mesotocin in increasing concentrations (10⁻¹⁰ to 10⁻⁶ M)

    • Record current amplitude, activation kinetics, and desensitization properties

  • MAPK pathway activation:

    • Stimulate receptor-expressing cells with mesotocin

    • Harvest cells at different time points (5, 15, 30, 60 minutes)

    • Perform Western blot analysis for phosphorylated ERK1/2

    • Quantify the degree and kinetics of MAPK activation

  • Receptor internalization studies:

    • Generate GFP-tagged receptor constructs

    • Monitor receptor trafficking using confocal microscopy

    • Quantify internalization rate and recycling dynamics

How does the mesotocin receptor contribute to osmoregulation in amphibians?

The mesotocin receptor plays a crucial role in amphibian osmoregulation through multiple mechanisms:

  • Urinary bladder effects:

    • Activation of MTR in bladder epithelial cells increases membrane permeability to water

    • This occurs through insertion of aquaporin water channels into the apical membrane

    • The effect facilitates water reabsorption during periods of dehydration or terrestrial activity

    • Pharmacological studies indicate this response is mediated through the inositol phosphate/calcium pathway

  • Renal function:

    • MTR expression in kidney tissues suggests direct effects on renal handling of water and electrolytes

    • Mesotocin likely influences glomerular filtration rate and tubular reabsorption processes

    • The receptor may mediate adaptive responses to osmotic challenges encountered in variable environments

  • Integrated physiological response:

    • Coordination between central (brain) and peripheral (kidney, bladder) MTR activation

    • Allows for complex behavioral and physiological adaptations to water availability

    • Represents an evolutionary precursor to mammalian osmoregulatory mechanisms

What comparative insights does the Bufo marinus mesotocin receptor provide for understanding mammalian oxytocin receptor function?

The Bufo marinus mesotocin receptor offers valuable comparative insights for understanding mammalian oxytocin receptor function:

  • Structural homology:

    • The 389 amino acid polypeptide of MTR shows significant structural similarity to mammalian oxytocin receptors

    • Key differences exist in the extracellular loops involved in ligand binding

    • Comparative sequence analysis reveals evolutionary conservation of G-protein coupling domains

  • Pharmacological comparisons:

    • Both receptors demonstrate highest affinity for their endogenous ligands (mesotocin for MTR, oxytocin for OTR)

    • Cross-reactivity exists (mesotocin binds to OTR and oxytocin binds to MTR)

    • Antagonist sensitivity profiles differ in important ways that highlight receptor specialization

  • Signaling pathway conservation:

    • Both receptors couple to the inositol phosphate/calcium pathway

    • The comparable electrophysiological response in heterologous expression systems suggests conservation of basic signaling mechanisms

    • Differences in desensitization kinetics and receptor trafficking may reflect adaptation to species-specific physiological demands

  • Translational implications:

    • Understanding the evolutionary modifications that led to mammalian oxytocin receptors

    • Insights for drug development targeting oxytocin/vasopressin receptor family

    • Potential for developing selective ligands based on structural differences

What mutagenesis strategies can identify critical residues for mesotocin binding specificity?

Systematic mutagenesis approaches can effectively identify critical residues determining mesotocin binding specificity:

  • Alanine scanning mutagenesis:

    • Systematically replace each amino acid in predicted binding regions with alanine

    • Focus on extracellular loops and transmembrane domains involved in ligand recognition

    • Evaluate each mutant for changes in binding affinity and signaling efficacy

    • Identify residues essential for mesotocin binding versus those involved in binding related peptides

  • Chimeric receptor approach:

    • Construct hybrid receptors combining domains from mesotocin and related receptors (vasotocin, isotocin)

    • Evaluate which domains confer ligand specificity

    • Create progressively refined chimeras to narrow down specific regions

    • Particularly useful for identifying domains responsible for the preferential binding of mesotocin over other related hormones

  • Site-directed mutagenesis based on molecular modeling:

    • Develop homology models based on crystal structures of related receptors

    • Predict key interaction points between mesotocin and receptor

    • Design targeted mutations to test model predictions

    • Validate models through functional characterization of mutants

  • Reciprocal mutations:

    • Identify non-conserved residues between mesotocin and oxytocin receptors

    • Create reciprocal mutations (changing MTR residues to OTR equivalents and vice versa)

    • Test if these changes "switch" the pharmacological profiles of the receptors

    • Particularly valuable for understanding evolutionary adaptations in binding specificity

How can advanced imaging techniques be applied to study mesotocin receptor dynamics?

Advanced imaging techniques provide powerful tools for investigating mesotocin receptor dynamics:

  • Fluorescence resonance energy transfer (FRET):

    • Generate receptor constructs with appropriate fluorophore pairs (CFP/YFP or GFP/RFP)

    • Monitor receptor-G protein interactions in real-time

    • Measure conformational changes upon ligand binding

    • Quantify dimerization/oligomerization dynamics

  • Bioluminescence resonance energy transfer (BRET):

    • Tag receptors with luciferase and fluorescent protein partners

    • Lower background compared to FRET for certain applications

    • Ideal for monitoring protein-protein interactions in living cells

    • Can be adapted for high-throughput screening applications

  • Single-particle tracking:

    • Label receptors with quantum dots or other photostable fluorophores

    • Track individual receptor molecules in the plasma membrane

    • Analyze diffusion characteristics and clustering behavior

    • Determine how ligand binding alters receptor mobility

  • Super-resolution microscopy:

    • Apply techniques such as PALM, STORM, or STED

    • Visualize receptor organization beyond the diffraction limit

    • Map receptor distribution in specialized membrane domains

    • Correlate nanoscale organization with functional responses

  • Fluorescence recovery after photobleaching (FRAP):

    • Selectively photobleach fluorescently tagged receptors in defined membrane regions

    • Monitor recovery of fluorescence to measure lateral mobility

    • Compare dynamics before and after ligand stimulation

    • Assess the impact of cytoskeletal elements on receptor diffusion

What are the most promising future research directions for the Bufo marinus mesotocin receptor?

Several promising research directions can advance our understanding of the Bufo marinus mesotocin receptor:

  • Structural biology approaches:

    • Cryo-EM or X-ray crystallography studies of the receptor in various states

    • Determination of the three-dimensional structure with bound ligands

    • Molecular dynamics simulations to understand conformational changes during activation

  • Systems biology integration:

    • Transcriptomic and proteomic profiling of tissues expressing MTR

    • Network analysis of mesotocin signaling pathways

    • Integration with other hormonal systems in amphibian adaptation

  • Comparative receptor biology:

    • Expanded evolutionary analysis across diverse amphibian species

    • Correlation of receptor properties with ecological niches and environmental adaptations

    • Insights into the evolution of the oxytocin/vasopressin receptor family

  • Developmental regulation:

    • Characterization of MTR expression patterns during metamorphosis

    • Role in the transition from aquatic to terrestrial lifestyles

    • Hormonal regulation of receptor expression during different life stages

  • Advanced pharmacological applications:

    • Development of selective mesotocin receptor modulators

    • Potential applications in comparative physiology and endocrinology

    • Novel research tools for investigating oxytocin/vasopressin receptor biology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.