Recombinant Bufo marinus Rhodopsin (RHO)

Shipped with Ice Packs
In Stock

Description

Activation Mechanism

Upon light absorption, 11-cis-retinal isomerizes to all-trans-retinal, triggering conformational changes that activate the G-protein transducin. Key intermediates include:

  • Bathorhodopsin: Forms within picoseconds, with distorted all-trans bonds .

  • Metarhodopsin II: Deprotonated Schiff base state critical for signaling .

Stability and Renewal

Studies in Bufo marinus rods show:

  • No detectable differences in absorption spectra, dichroism, or lateral diffusion rates between old (distal) and new (proximal) rhodopsin .

  • Regeneration of rhodopsin post-bleaching occurs faster in basal disks than distal ones, suggesting compartmentalized retinoid recycling .

Trafficking and Membrane Dynamics

  • Actin Dependency: Rhodopsin incorporation into disk membranes occurs independently of F-actin, unlike peripherin/rds, which requires actin for proper localization .

  • Recycling Mechanisms:

    • CME (Clathrin-Mediated Endocytosis): Observed in blue light-activated rhodopsin, involving arrestin co-internalization .

    • Non-CME: Green light triggers faster recycling via rhodopsin phosphatase (RdgC), bypassing arrestin interaction .

Disease Modeling

Mutations in rhodopsin (e.g., P23H, T17M) linked to retinitis pigmentosa (RP) highlight:

  • ER Stress: Misfolded rhodopsin activates the unfolded protein response (UPR), leading to calcium dysregulation and caspase-mediated apoptosis .

  • Therapeutic Targets: Calpain inhibitors and caspase-7 blockers delay photoreceptor degeneration in RP models .

Comparative Analysis with Other Species

FeatureBufo marinus RhodopsinBovine Rhodopsin
Thermal Isomerization RateLower than cone pigments, higher than bovine Extremely low (high photon sensitivity)
Chromophore ExchangeLimited retinal exchange in dark conditionsNo retinal exchange in dark
Expression SystemsRecombinant forms used for ELISA studies Widely used in structural studies

Technical Considerations for Experimental Use

  • ELSA Kits: Commercial kits (e.g., CBM15) utilize recombinant Bufo marinus rhodopsin for antibody binding assays, emphasizing full-length protein integrity .

  • Photobleaching: Immediate upon light exposure, requiring dark-adapted protocols for regeneration studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RHO; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Rhinella marina (Cane toad) (Bufo marinus)
Target Names
RHO
Target Protein Sequence
MNGTEGPNFYIPMSNKTGVVRSPFEYPQYYLAEPWQYSVLCAYMFLLILLGFPINFMTLY VTIQHKKLRTPLNYILLNLAFANHFMVLCGFTVTMYSSMNGYFVFGQTGCYVEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFSENHAIMGVAFTWIMALACAAPPLFGWSRYIP EGMQCSCGVDYYTLKPEVNNESFVIYMFVVHFLIPLIIIFFCYGRLVCTVKEAAAQQQES ATTQKAEKEVTRMVIIMVVFFLICWVPYASVAFFIFTHQGSEFGPVFMTIPAFFAKSSSI YNPVIYIMLNKQFRNCMITTLCCGKNPFGDEDASSAATSKTEASSVSSSQVSPA
Uniprot No.

Target Background

Function
A photoreceptor crucial for low-light vision and post-natal photoreceptor cell viability. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling via G-proteins. Subsequent receptor phosphorylation, mediated by arrestin, displaces the bound G-protein alpha subunit, thereby terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Bufo marinus rhodopsin and why is it used in visual neuroscience research?

Bufo marinus (cane toad) rhodopsin is a G-protein coupled receptor found in rod photoreceptor cells that initiates the visual transduction cascade upon absorption of light. This rhodopsin is particularly valuable for research due to its stability, spectral properties (absorption maximum at ~505 nm), and the ease of obtaining sufficient quantities from the large Bufo marinus retinas . The protein consists of the opsin protein moiety covalently linked to the chromophore 11-cis retinal. Researchers select this species' rhodopsin for recombinant expression because Bufo marinus provides a model system that offers advantages in spectroscopic measurements and structural stability compared to mammalian equivalents, while maintaining fundamental similarities in the phototransduction cascade mechanisms .

What are the fundamental structural and functional characteristics of Bufo marinus rhodopsin?

Bufo marinus rhodopsin exhibits several key characteristics important for research applications:

  • Absorption spectrum: Demonstrates a characteristic peak at approximately 505 nm, comparable to the rhodopsin from other vertebrates

  • Concentration: When examined in native rod outer segments (ROS), the rhodopsin concentration appears uniform throughout the cell

  • Dichroism: Shows strong dichroic properties due to the oriented arrangement of the chromophore within the membrane disks

  • Photoconversion rates: Undergoes a series of conformational changes upon light absorption, leading to the formation of metarhodopsin intermediates

  • Lateral diffusion: The protein can diffuse laterally within the disk membrane, which can be measured experimentally

  • Regeneration capability: After bleaching, the protein can be regenerated with appropriate retinoids

These properties make Bufo marinus rhodopsin an excellent model for studying photoreceptor function, membrane protein dynamics, and G-protein coupled receptor signaling mechanisms.

What expression systems are most effective for producing recombinant Bufo marinus rhodopsin?

Several expression systems have proven effective for recombinant Bufo marinus rhodopsin production, each with distinct advantages:

  • Mammalian cell lines (HEK293, COS-7): These systems provide proper post-translational modifications and membrane insertion, resulting in functional protein. The cells can be grown with 11-cis retinal supplementation to produce properly folded pigment with spectral properties similar to native rhodopsin .

  • Insect cell lines (Sf9, High Five): The baculovirus expression system offers higher yields than mammalian systems while maintaining appropriate post-translational modifications. This system is particularly valuable for structural studies requiring larger quantities of purified protein.

  • Transgenic mice: For in vivo studies, transgenic mice can be engineered to express Bufo marinus rhodopsin, though careful design is needed to prevent interference with endogenous mouse rhodopsin .

When selecting an expression system, researchers should consider yield requirements, downstream applications, and the need for post-translational modifications such as glycosylation and palmitoylation, which affect rhodopsin trafficking and function.

What are the optimal methods for isolation and purification of recombinant Bufo marinus rhodopsin?

The isolation and purification of recombinant Bufo marinus rhodopsin typically follows these key steps:

  • Cell harvesting and lysis: Expressing cells are collected and lysed in buffer containing appropriate detergents (commonly 1% n-dodecyl-β-D-maltoside or digitonin) to solubilize the membrane-embedded rhodopsin while maintaining its native conformation.

  • Affinity chromatography: For recombinant protein, affinity tags such as 1D4 epitope tag, His-tag, or FLAG-tag facilitate purification. The 1D4 monoclonal antibody approach is particularly effective as it binds the C-terminus of rhodopsin with high specificity.

  • Size exclusion chromatography: This step removes aggregates and contaminants based on molecular size, yielding homogeneous rhodopsin preparations.

  • Quality assessment: Purified rhodopsin quality is assessed through spectrophotometric analysis, with A280/A500 ratio values of 1.6-1.8 indicating high purity and proper folding with bound chromophore.

All purification steps should be conducted under dim red light (>650 nm) to prevent photoactivation of the rhodopsin during the isolation process, and temperature control (typically 4°C) is crucial to minimize protein denaturation.

How can researchers accurately characterize the spectral properties of recombinant rhodopsin?

Accurate characterization of recombinant Bufo marinus rhodopsin spectral properties requires several complementary approaches:

  • UV-Visible absorption spectroscopy: The primary method for determining absorption spectrum and concentration. Properly folded Bufo marinus rhodopsin exhibits a characteristic absorption maximum at approximately 505 nm in the dark state . After photobleaching, this peak disappears as the chromophore isomerizes. The difference spectrum (dark minus light) provides valuable information about rhodopsin content and spectral properties.

  • Microspectrophotometry (MSP): This technique allows measurements of absorption spectra in single rod outer segments or small samples. MSP combines infrared full-field viewing with rapid scanning of the visible spectrum, enabling detailed characterization of rhodopsin in situ .

  • Fluorescence spectroscopy: While rhodopsin itself has limited fluorescence, the retinal chromophore and specific amino acid residues can be monitored through fluorescence techniques, providing information about protein conformation and chromophore environment.

  • Circular dichroism (CD): This technique provides information about the secondary structure of the protein and can detect changes in protein folding upon light activation.

When characterizing recombinant rhodopsin, it is essential to compare its spectral properties with native rhodopsin to ensure proper folding and functionality. Researchers should also examine the stability of the spectral properties over time and under different buffer conditions.

What techniques are available for studying rhodopsin photoactivation and conformational changes?

Several advanced techniques allow researchers to investigate rhodopsin photoactivation and conformational changes:

  • Time-resolved spectroscopy: This approach captures spectral changes occurring during the photocycle, from femtoseconds to seconds after light activation. It allows identification of rhodopsin photointermediates (bathorhodopsin, lumirhodopsin, metarhodopsin I, metarhodopsin II) and determination of their kinetics.

  • FTIR spectroscopy: Fourier-transform infrared spectroscopy detects structural changes in the protein backbone and side chains during photoactivation, providing molecular details about conformational changes.

  • Fluorescence resonance energy transfer (FRET): By labeling specific sites on rhodopsin with fluorescent probes, researchers can monitor distance changes between these sites during activation, yielding information about protein dynamics.

  • Site-directed spin labeling (SDSL) with EPR spectroscopy: This approach measures conformational changes at specific sites within the protein, providing detailed information about local structural rearrangements.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry identifies amino acid residues that come into proximity during different activation states.

When applying these techniques to recombinant Bufo marinus rhodopsin, researchers should consider the potential influence of expression system, purification method, and reconstitution environment on the protein's photochemical properties.

How can recombinant Bufo marinus rhodopsin be used to study G-protein activation mechanisms?

Recombinant Bufo marinus rhodopsin serves as an excellent model for investigating G-protein activation mechanisms through several experimental approaches:

  • G-protein activation assays: Light-activated recombinant rhodopsin catalyzes GDP/GTP exchange on transducin (Gt), which can be measured using radioactive GTPγS binding assays or fluorescent GDP/GTP analogs. These assays quantify both the rate and extent of G-protein activation.

  • Reconstitution systems: Purified recombinant rhodopsin can be reconstituted into liposomes or nanodiscs along with purified G-proteins to create defined systems for studying activation mechanisms with precise control over component concentrations and membrane composition.

  • Site-directed mutagenesis: Specific amino acid residues in rhodopsin can be mutated to determine their roles in G-protein binding and activation. By comparing the effects of these mutations in Bufo marinus rhodopsin with those in other species, researchers can identify conserved and species-specific determinants of G-protein coupling.

  • Structural biology approaches: Cryo-electron microscopy and X-ray crystallography of rhodopsin-G-protein complexes provide atomic-level insights into the molecular interfaces and conformational changes involved in signal transduction.

These approaches allow researchers to address fundamental questions about GPCR signaling mechanisms, including: How do conformational changes in rhodopsin propagate to enable G-protein binding? What structural elements determine G-protein coupling specificity? How does the lipid environment influence the efficiency and kinetics of G-protein activation?

What approaches can be used to investigate rhodopsin lateral diffusion and its functional implications?

Investigation of rhodopsin lateral diffusion provides important insights into membrane organization and visual signaling. Several methodologies are available:

  • Fluorescence recovery after photobleaching (FRAP): This technique measures diffusion rates by tracking the movement of fluorescently labeled rhodopsin molecules back into a bleached area. For recombinant Bufo marinus rhodopsin, this often involves creating fusion constructs with fluorescent proteins or specific labeling with fluorescent dyes.

  • Single-particle tracking (SPT): By labeling individual rhodopsin molecules with quantum dots or gold nanoparticles, researchers can track their movement at nanometer resolution, revealing diffusion patterns and potential membrane compartmentalization.

  • Microspectrophotometric approaches: As described in the literature, a specialized approach involves using a measuring beam to cause localized bleaching of rhodopsin and then monitoring absorbance changes that occur due to both photoconversion and lateral diffusion of unbleached rhodopsin into the beam area . This technique yields a double-branched absorbance change: a fast component related to photoconversion and a slower component controlled by lateral diffusion rates.

  • Fluorescence correlation spectroscopy (FCS): This technique measures the diffusion of fluorescently labeled rhodopsin by analyzing fluctuations in fluorescence intensity as molecules move through a small observation volume.

When studying lateral diffusion, it's important to consider how experimental conditions affect measurement results. For example, glutaraldehyde fixation (4% for 30 minutes) has been shown to effectively prevent lateral diffusion by cross-linking membrane components , making it useful as a control condition.

How do recombinant rhodopsin systems help elucidate mechanisms of retinal disease?

Recombinant Bufo marinus rhodopsin systems provide valuable insights into retinal disease mechanisms through several approaches:

  • Disease-associated mutation modeling: By introducing mutations associated with human retinal diseases (such as retinitis pigmentosa) into recombinant Bufo marinus rhodopsin, researchers can study how these mutations affect protein folding, stability, chromophore binding, and signaling. Comparison with wild-type rhodopsin provides mechanistic insights into disease pathogenesis.

  • Protein stability and misfolding analysis: Many retinal diseases involve rhodopsin misfolding and aggregation. Recombinant systems allow detailed biochemical and biophysical characterization of these processes, including thermal stability measurements, aggregation propensity assessment, and analysis of interactions with cellular quality control machinery.

  • Cell-based models: Expressing recombinant Bufo marinus rhodopsin variants in cell lines enables analysis of cellular responses to protein misfolding, including endoplasmic reticulum stress, unfolded protein response activation, and cell death pathways.

  • Therapeutic screening platforms: Recombinant systems provide platforms for screening potential therapeutic compounds that might stabilize mutant rhodopsin, promote proper folding, or enhance cellular proteostasis mechanisms.

Studies with rhodopsin knockout mice demonstrate that complete absence of rhodopsin prevents normal rod outer segment development and leads to rod cell degeneration over time . By 30 days of age, 10-15% of rod nuclei are lost, and by 90 days, over 90% are lost . These findings parallel observations in human retinitis pigmentosa caused by rhodopsin mutations.

What are common challenges in expressing functional recombinant Bufo marinus rhodopsin?

Researchers face several challenges when expressing functional recombinant Bufo marinus rhodopsin:

  • Low expression yields: Membrane proteins often express poorly in heterologous systems. Optimization strategies include:

    • Modifying the N-terminal signal sequence

    • Adding fusion partners to enhance folding

    • Optimizing codon usage for the expression system

    • Using inducible expression systems to minimize toxicity

  • Chromophore availability: Proper folding of recombinant rhodopsin requires 11-cis retinal, which is not commercially available and must be synthesized or isolated from dark-adapted retinas. Alternatives include:

    • Using 9-cis retinal (commercially available) to form isorhodopsin, which has similar properties to native rhodopsin

    • Developing cell lines that express enzymes for converting all-trans retinal to 11-cis retinal

  • Protein misfolding: Ensuring proper folding requires careful optimization of:

    • Expression temperature (often lowered to 27-30°C)

    • Inclusion of chemical chaperones in the culture medium

    • Co-expression of molecular chaperones

    • Addition of chromophore during protein synthesis

  • Detergent selection: The choice of detergent for solubilization and purification significantly affects protein stability and function. A detergent screen (including DDM, DMPC, digitonin) is often necessary to identify optimal conditions for maintaining native-like properties.

Careful monitoring of protein quality using spectroscopic analysis is essential throughout the expression and purification process to ensure that the recombinant protein maintains native-like properties.

How can researchers accurately measure and interpret rhodopsin regeneration kinetics?

Accurate measurement and interpretation of rhodopsin regeneration kinetics require careful experimental design and consideration of several factors:

  • Experimental approaches:

    • In vivo regeneration: Bleaching living eyes in intact animals, allowing dark adaptation for regeneration, then isolating and examining ROS for sites of pigment regeneration

    • In vitro regeneration: Isolating dark-adapted ROS, bleaching to completion, removing endogenous retinal with hydroxylamine, then monitoring regeneration upon addition of 11-cis or 9-cis retinal

    • Eyecup preparation: Bleaching eyecups to completion, then monitoring regeneration under physiological conditions

  • Critical controls and considerations:

    • Ensuring complete bleaching (>95%) before regeneration experiments to prevent confounding results from unbleached pigment

    • Controlling temperature during regeneration (typically 30±1°C for Bufo marinus)

    • Using appropriate buffers that maintain cellular viability and retinoid solubility

    • Accounting for the point of entry of regeneration retinoids and their concentrations, which can significantly affect observed kinetics

  • Data analysis approaches:

    • Fitting regeneration data to appropriate kinetic models (first-order, two-phase, or more complex models depending on the regeneration conditions)

    • Distinguishing between rate-limiting steps (retinoid delivery, binding, protein conformational changes)

    • Comparing proximal versus distal regions of rod outer segments to assess potential differences in regeneration capacity

It's important to note that in living toad eyes, regeneration appears to proceed from the base of the rod toward the tip , suggesting that the process may be influenced by cellular machinery involved in retinoid transport and processing.

What methods are available for assessing the impact of mutations on rhodopsin structure and function?

Comprehensive assessment of mutation effects on recombinant Bufo marinus rhodopsin requires multiple complementary approaches:

  • Spectroscopic analysis:

    • UV-visible spectroscopy to assess chromophore binding (A500 peak) and protein folding (A280/A500 ratio)

    • Difference spectroscopy to determine spectral shifts that might indicate altered chromophore-protein interactions

    • Circular dichroism to assess secondary structure changes

    • Fluorescence spectroscopy to monitor tertiary structure perturbations

  • Stability assessments:

    • Thermal stability measurements (thermal denaturation curves)

    • Chemical stability (resistance to detergents and denaturants)

    • Photobleaching kinetics and photosensitivity measurements

    • Dark state stability (rate of spontaneous activation)

  • Functional assays:

    • G-protein activation assays (rate and extent of transducin activation)

    • Arrestin binding studies

    • Phosphorylation by rhodopsin kinase

    • Meta II decay kinetics (stability of the active state)

  • Cellular studies:

    • Subcellular localization in expression systems

    • Trafficking efficiency to the plasma membrane

    • Formation of inclusions or aggregates

    • Impact on cell viability

When interpreting mutation effects, it's valuable to compare results across multiple experimental systems. For example, studies in rhodopsin knockout mice show that complete absence of rhodopsin prevents normal rod outer segment development and leads to rod cell degeneration , providing important context for interpreting the effects of specific mutations on rhodopsin function in cellular and animal models.

How should researchers compare recombinant rhodopsin properties with native rhodopsin?

Meaningful comparison between recombinant and native Bufo marinus rhodopsin requires systematic analysis across multiple parameters:

When discrepancies are observed, researchers should investigate whether they represent true functional differences or artifacts of the recombinant expression system, such as incomplete post-translational modifications or effects of non-native lipid environments.

What standards should be applied to ensure reproducibility in rhodopsin research?

Ensuring reproducibility in recombinant Bufo marinus rhodopsin research requires adherence to several key standards:

  • Detailed reporting of methods:

    • Complete description of expression constructs, including all modifications to the native sequence (tags, mutations, fusion partners)

    • Expression system conditions (cell type, media composition, induction parameters, temperature)

    • Purification protocols with specific detergent concentrations, buffer compositions, and chromatography conditions

    • Spectroscopic measurement parameters (bandwidth, scan speed, temperature, light conditions)

  • Rigorous quality control metrics:

    • Purity assessment through SDS-PAGE, size exclusion chromatography, and spectroscopic criteria (A280/A500 ratio)

    • Verification of proper folding through spectroscopic fingerprinting

    • Stability monitoring during storage and experiments

    • Functional validation through standardized assays

  • Appropriate controls and reference standards:

    • Inclusion of wild-type rhodopsin controls alongside mutants

    • Use of validated reference samples when comparing between batches

    • Internal controls for environmental variables (temperature, pH, ionic strength)

    • Standard samples for calibrating equipment and normalizing between laboratories

  • Data analysis transparency:

    • Clear description of analysis methods, including software and algorithms

    • Reporting of both raw and processed data

    • Statistical methods appropriate for the experimental design

    • Disclosure of replicate numbers and variability measures

Adopting these standards helps ensure that findings from different laboratories can be meaningfully compared and integrated, advancing our collective understanding of rhodopsin structure and function.

How can researchers integrate rhodopsin functional data with structural information?

Integrating functional data with structural information provides powerful insights into recombinant Bufo marinus rhodopsin mechanisms:

  • Structure-function correlation approaches:

    • Mapping functional data from mutagenesis studies onto known rhodopsin structures

    • Analyzing evolutionary conservation patterns in relation to functional sites

    • Computational modeling of conformational changes and dynamic properties

    • Molecular dynamics simulations to predict effects of mutations or conditions

  • Integrated experimental strategies:

    • Site-directed spin labeling with EPR spectroscopy to correlate structure with conformational changes

    • Disulfide crosslinking studies to validate proximity relationships in different functional states

    • Hydrogen-deuterium exchange mass spectrometry to identify regions with altered dynamics

    • FRET measurements to determine distance changes between specific sites during activation

  • Visualization and interpretation tools:

    • Creating molecular graphics that highlight residues of functional importance

    • Developing dynamic models that represent the rhodopsin activation process

    • Using computational docking to predict interactions with binding partners

  • Data integration frameworks:

    Structural ElementLocationFunctionExperimental Evidence
    Retinal binding pocketTM helices 3,5,6,7Chromophore bindingSpectroscopic analysis, mutagenesis
    DRY motifIntracellular end of TM3G-protein activationG-protein activation assays, mutagenesis
    NPxxY motifTM7Conformational changeFTIR, EPR studies, mutagenesis
    Cytoplasmic helix 8C-terminal to TM7G-protein interactionBinding studies, mutagenesis

This integrated approach allows researchers to develop comprehensive models of how rhodopsin structure enables its function as a light receptor and G-protein-coupled receptor, providing insights applicable to understanding other GPCRs and developing targeted therapeutics for visual disorders.

What emerging technologies are advancing recombinant rhodopsin research?

Several cutting-edge technologies are transforming recombinant Bufo marinus rhodopsin research:

  • Cryo-electron microscopy (Cryo-EM): Enables visualization of rhodopsin structure in different activation states without crystallization, potentially revealing conformational dynamics not accessible through X-ray crystallography.

  • Nanobody-stabilized conformational states: Using camelid antibody fragments (nanobodies) to stabilize specific rhodopsin conformations, allowing structural and functional characterization of transient intermediate states.

  • Optogenetic applications: Engineered rhodopsin variants with altered spectral and kinetic properties for use as optogenetic tools, enabling precise control of cellular signaling with light.

  • Cell-free expression systems: Advanced cell-free protein synthesis platforms that can produce functional rhodopsin with precise control over reaction conditions and incorporation of non-canonical amino acids.

  • Single-molecule force spectroscopy: Techniques like atomic force microscopy (AFM) and optical tweezers to measure the mechanical properties and conformational changes of individual rhodopsin molecules during activation.

  • In situ structural biology: Methods like cryo-electron tomography that allow visualization of rhodopsin in its native membrane environment, providing insights into organization and interactions within photoreceptor cells.

These technologies promise to reveal new aspects of rhodopsin structure, dynamics, and function that have been inaccessible with conventional approaches, potentially leading to breakthroughs in understanding visual signal transduction and developing therapies for retinal diseases.

How can cross-species comparisons of recombinant rhodopsins inform evolutionary adaptations in visual systems?

Cross-species comparison of recombinant rhodopsins provides valuable insights into visual system evolution:

  • Spectral tuning mechanisms: By expressing and characterizing rhodopsins from species adapted to different light environments (deep-sea, nocturnal, diurnal), researchers can identify amino acid substitutions responsible for spectral tuning. Comparing Bufo marinus rhodopsin (λmax ~505 nm) with rhodopsins from other species reveals how specific residues in the retinal binding pocket modulate absorption properties.

  • G-protein coupling efficiency: Different species may exhibit variation in the strength and kinetics of G-protein activation. Recombinant expression of rhodopsins from multiple species allows quantitative comparison of signaling efficiency in standardized assays.

  • Thermal stability adaptations: Species living in different thermal environments often show adaptations in protein stability. Comparative thermal denaturation studies of recombinant rhodopsins can reveal structural features that confer resistance to thermal stress.

  • Regeneration kinetics: The rate of pigment regeneration after bleaching varies across species, reflecting adaptations to different light intensities. Comparing regeneration kinetics of recombinant rhodopsins provides insights into mechanisms of dark adaptation.

  • Molecular evolution analysis:

    SpeciesλmaxKey Binding Pocket ResiduesHabitatEvolutionary Adaptations
    Bufo marinus505 nm[Specific residues]Terrestrial, nocturnal[Specific adaptations]
    [Species 2][Value][Specific residues][Habitat][Specific adaptations]
    [Species 3][Value][Specific residues][Habitat][Specific adaptations]
    [Species 4][Value][Specific residues][Habitat][Specific adaptations]

This evolutionary perspective not only reveals how visual pigments have adapted to different environments but also identifies conserved features essential for rhodopsin function across vertebrates, potentially highlighting targets for therapeutic intervention in visual disorders.

What are the implications of rhodopsin research for developing treatments for retinal degenerative diseases?

Research on recombinant Bufo marinus rhodopsin has significant implications for developing treatments for retinal degenerative diseases:

  • Pharmacological chaperone development: Studies of rhodopsin folding and stability inform the design of small molecules that can stabilize misfolded rhodopsin mutants, potentially slowing retinal degeneration in conditions like retinitis pigmentosa.

  • Gene therapy approaches: Understanding the effects of rhodopsin expression levels on photoreceptor health guides gene therapy strategies. Studies in rhodopsin knockout mice show that both complete absence and reduced levels of rhodopsin affect photoreceptor development and survival . This suggests that gene therapy approaches must carefully control rhodopsin expression levels to be effective.

  • Cell replacement strategies: Research on rhodopsin expression and trafficking informs protocols for differentiating stem cells into photoreceptors for transplantation. Proper rhodopsin folding and transport to outer segments are critical benchmarks for functional photoreceptor replacements.

  • Optogenetic vision restoration: Insights from rhodopsin structure-function studies enable the development of optimized optogenetic tools for vision restoration in patients who have lost photoreceptors. These engineered photoreceptive proteins can potentially restore light sensitivity to remaining retinal neurons.

  • Neuroprotective strategies: Studies in rhodopsin knockout mice reveal that photoreceptor degeneration follows a predictable time course, with 10-15% of rod nuclei lost by 30 days and over 90% lost by 90 days . This progressive degeneration pattern provides a window for intervention with neuroprotective therapies aimed at preserving remaining photoreceptors.

The translational potential of this research is highlighted by the finding that human patients with autosomal recessive retinitis pigmentosa caused by null mutations in both rod opsin alleles show severely diminished cone responses , suggesting that rod-cone interdependence must be considered in therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.