Recombinant Bufo marinus Sodium/potassium-transporting ATPase subunit beta-3

Shipped with Ice Packs
In Stock

Description

Role in Na,K-ATPase Activity

The beta-3 subunit serves as a critical component of the Na,K-ATPase complex, which functions by exporting three Na+ ions and importing two K+ ions across cell membranes at the expense of ATP hydrolysis . When recombinantly expressed and paired with appropriate alpha subunits, ATP1B3 forms functional Na,K pumps with distinct properties .

Research utilizing Xenopus oocyte expression systems has demonstrated that the beta-3 subunit can effectively associate with alpha-1 subunits to create active enzyme complexes . These studies reveal that while both beta-1 and beta-3 can pair with the alpha-1 subunit, the resulting enzyme complexes exhibit subtle but significant functional differences .

Modulation of Ion Transport Kinetics

One of the most notable characteristics of recombinant Bufo marinus ATP1B3 is its ability to modulate the ion transport kinetics of Na,K-ATPase. Experimental evidence has shown that the beta subunit isoform significantly influences the potassium activation properties of the enzyme complex .

Studies comparing Na,K-ATPase complexes containing different beta subunits have revealed specific differences in potassium affinity parameters. The following table summarizes these findings:

ParameterAlpha 1-Beta 1 ComplexAlpha 1-Beta 3 ComplexStatistical Significance
K+ half-activation constant (K1/2) with external Na+0.87 ± 0.08 mM (n=16)1.29 ± 0.07 mM (n=17)p < 0.005
K+ half-activation constant (K1/2) without external Na+No significant differenceNo significant differenceNot significant
Inhibition constant (Ki) for ouabain53 ± 3 µM (n=7)57 ± 3.0 µM (n=8)Not significant
Maximum Na,K-pump currentsIdenticalIdenticalNot significant

These data indicate that the beta-3 subunit specifically affects the apparent affinity for potassium ions, but only in the presence of external sodium ions . This suggests that the influence of beta-3 on potassium affinity is not directly related to the potassium binding site but may involve interactions with sodium ions or conformational changes induced by sodium binding .

Studies of Ion Transport Mechanisms

Recombinant Bufo marinus ATP1B3 has been extensively utilized in research to elucidate the mechanisms of sodium and potassium transport. The expression of this protein in experimental systems has facilitated investigations into:

  1. Sequential binding and release of sodium ions from multiple binding sites

  2. Influence of beta subunits on ion affinity and transport kinetics

  3. Electrogenicity of ion transport and associated charge movements

  4. Effects of inhibitors on Na,K-ATPase function

Charge Translocation and Current Studies

Research employing recombinant Bufo marinus Na+/K+ ATPase has provided valuable insights into charge translocation during enzyme function. Studies have shown that in the absence of potassium, the Na+/K+ ATPase carries on electroneutral Na+/Na+ exchange and produces transient currents with both faster and slower components in response to voltage steps .

These transient currents represent the sequential release of Na+ ions from three binding sites, with components of different speeds revealed through exponential analysis of experimental data . Research has demonstrated that the slow component can exist independently, providing important mechanistic insights .

Studies involving inhibitors such as oligomycin have shown that this compound favors the 2Na+-occluded state without affecting the conformational change of the Na+/K+ ATPase . Specifically, oligomycin almost completely blocks K+-activated current through a voltage-independent binding mechanism and affects faster components without impacting the slow component carried by the first Na+ release/rebinding .

Comparative Studies with Other ATPases

Recombinant Bufo marinus ATP1B3 has proven valuable in comparative studies with other ATPases, including the colonic H,K-ATPase. Research has shown that expression of the Bufo marinus Na,K-ATPase in Xenopus oocytes affects intracellular Na+ homeostasis in a manner similar to the colonic H,K-ATPase .

Specifically, intracellular Na+ activity is lower in oocytes expressing either the colonic H,K-ATPase or the Bufo marinus Na,K-ATPase compared to oocytes expressing the gastric H,K-ATPase or a beta subunit alone . This finding suggests functional similarities between these ion transport systems.

Expression Systems and Production Methods

Recombinant Bufo marinus ATP1B3 can be produced using various expression systems. Commercial preparations are typically generated using:

  1. Yeast expression systems

  2. Escherichia coli (E. coli) expression systems

  3. Other eukaryotic expression systems

The choice of expression system can influence protein properties, including folding, post-translational modifications, and functional characteristics. For research applications requiring high purity, recombinant ATP1B3 is often produced with affinity tags (such as His tags) to facilitate purification .

Molecular Mechanism of Ouabain Resistance

A particularly significant research application of recombinant Bufo marinus ATP1B3 involves understanding the molecular mechanism of ouabain resistance in toads. Studies have shown that the alpha 1 isoform is necessary and sufficient to confer the ouabain-resistant phenotype, while the beta-3 (or beta-1) subunit can associate with alpha 1 equally well without affecting this resistance property .

The sequence of the alpha 1 isoform is characterized by two positively charged amino acids (Arg, Lys) at the N-terminal border of the H1-H2 extracellular loop and no charged amino acid at the C terminus . This pattern is distinct from the ouabain-resistant rat alpha 1 isoform and contributes to the unique pharmacological profile of the Bufo marinus Na,K-ATPase .

Comparative Functional Properties

When comparing Na,K-ATPase complexes containing different beta subunits, several functional properties have been characterized:

  1. K+ Activation: Alpha 1-beta 3 complexes show higher K1/2 values compared to alpha 1-beta 1 complexes in the presence of external Na+ .

  2. Ouabain Sensitivity: Both beta-1 and beta-3 containing complexes exhibit similar sensitivity to ouabain inhibition .

  3. Maximum Pump Currents: Complexes containing either beta-1 or beta-3 produce identical maximum Na,K-pump currents when expressed in Xenopus oocytes .

These findings indicate that while the beta subunit isoform does not affect the maximum transport capacity or inhibitor sensitivity of the Na,K-ATPase complex, it does modulate specific aspects of ion transport kinetics, particularly the apparent affinity for potassium ions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Sodium/potassium-transporting ATPase subunit beta-3; Sodium/potassium-dependent ATPase beta-3 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-279
Protein Length
full length protein
Species
Rhinella marina (Cane toad) (Bufo marinus)
Target Protein Sequence
MAKEENKSGEQSSSEWKQFIYNPSSGEILGRTASSWALILLFYLVFYGFLAGLFTLTMWVMLQTLDDSVPKYRDRVSFPGLMISPKSAGLEISFSKSDKSHMKSILKFFTHFYHHTMTPYKLQMCSARKAITTEQEGVEEKKSCQFNRSSLGPCAGLEGNEYFGYNDGSPCVLVKMNRIIGLKPDGNPHINCTSKAENISLQYYPEYGKIDLMYYPYYGKKTHVNYVQPLVAVKITPSNSTGTSEIVLECKLYGSPNLKNNDDRDKFLGRVNFKLEIKD
Uniprot No.

Target Background

Function
This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The precise function of this glycoprotein is unknown. Certain specific sequences of the beta subunit can modulate the activation of the Na,K-pump by extracellular potassium ions.
Protein Families
X(+)/potassium ATPases subunit beta family
Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Tissue Specificity
Abundantly in brain, eye and testis, at a lower extent in spleen.

Q&A

What is the basic structure of the Bufo marinus Na+/K+-ATPase beta-3 subunit?

The Na+/K+-ATPase beta-3 subunit from Bufo marinus is a non-catalytic component that associates with the alpha subunit to form a functional enzyme complex. Similar to its human counterpart, the structure likely includes a single transmembrane domain and an extracellular C-terminal domain that folds into an immunoglobulin-like structure . The C-terminal lobe may mediate cell adhesion properties in addition to its role in pump function . The beta-3 subunit works in conjunction with the catalytic alpha subunit, which is responsible for the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane.

The exact function of the beta-3 subunit is not fully elucidated, but research suggests it plays crucial roles in proper enzyme assembly, membrane targeting, and modulation of ion transport kinetics. Experimental approaches to study the structure include X-ray crystallography, cryo-electron microscopy, and computational modeling based on homology with more extensively characterized beta subunits from other species.

How does the Bufo marinus beta-3 subunit differ from other beta isoforms?

Research comparing beta-1 and beta-3 subunits of the Na+/K+-ATPase from Bufo marinus has revealed functional differences, particularly in ion transport kinetics. When co-expressed with the alpha-1 subunit, these beta isoforms form pumps with similar ouabain sensitivity but different potassium half-activation constants (K1/2) . This finding indicates that specific sequences within the beta subunit can influence the activation of the Na+/K+-pump by extracellular K+ ions .

What expression systems are most effective for producing recombinant Bufo marinus Na+/K+-ATPase beta-3?

For recombinant expression of Na+/K+-ATPase beta-3 subunit, several expression systems have been employed with varying degrees of success. The selection of an appropriate expression system depends on research objectives, required protein yield, and whether post-translational modifications are essential.

Based on available data for similar proteins, the following expression systems may be considered:

The methodology involves cloning the beta-3 cDNA into suitable expression vectors, transforming/transfecting the host system, inducing expression, and purifying the recombinant protein using affinity chromatography or other separation techniques. Each system requires optimization of expression conditions, including temperature, induction parameters, and purification protocols.

How can researchers optimize the co-expression of alpha and beta subunits for functional studies?

Optimizing co-expression of alpha and beta subunits is crucial for obtaining functional Na+/K+-ATPase complexes. Based on the research with Bufo marinus subunits, the following methodology has proven effective:

  • Balanced expression levels: When co-injecting alpha and beta subunit cRNAs into Xenopus oocytes, maintaining appropriate ratios is essential for optimal complex formation. Researchers typically determine the optimal ratio experimentally, often starting with a 1:1 molar ratio and adjusting as needed .

  • Expression timing: In some cases, sequential expression of subunits may improve assembly efficiency.

  • Verification of complex formation: Techniques such as co-immunoprecipitation, blue native PAGE, or fluorescence resonance energy transfer (FRET) can be used to confirm proper assembly of the alpha-beta complex.

  • Functional verification: Pump activity can be assessed using techniques such as K+-induced current measurements in voltage-clamped oocytes, as demonstrated in the Bufo marinus studies . This approach allows for direct measurement of pump function and can be used to compare different alpha-beta combinations.

For biochemical and structural studies requiring purified complexes, detergent solubilization and affinity purification strategies must be optimized to maintain the integrity of the alpha-beta interaction throughout the purification process.

What methods are most effective for measuring Na+/K+-ATPase activity in recombinant Bufo marinus beta-3-containing complexes?

Several complementary approaches can be used to assess the activity of Na+/K+-ATPase complexes containing the Bufo marinus beta-3 subunit:

  • Electrophysiological measurements: This approach, as demonstrated in the provided research, involves measuring K+-induced currents in voltage-clamped Xenopus oocytes expressing the recombinant pumps . This method allows for real-time monitoring of pump activity under various conditions and is particularly valuable for kinetic studies.

  • ATPase activity assays: Biochemical assays measuring ATP hydrolysis can be performed on purified or membrane-embedded pump complexes. These typically quantify either the release of inorganic phosphate or the consumption of ATP. The Na+/K+-ATPase-specific activity can be determined as the ouabain-sensitive portion of the total ATPase activity.

  • Rubidium uptake: As a potassium congener, 86Rb+ uptake can be used to measure the transport function of the pump.

  • Ouabain binding assays: Measuring the binding of radiolabeled ouabain can provide information about the number of functional pump units.

  • Phosphorylation studies: Analysis of the phosphorylated intermediate formed during the catalytic cycle can provide insights into the reaction mechanism.

Each method offers distinct advantages and limitations, and the selection depends on the specific research question. For comparative studies of different beta isoforms, a combination of approaches may provide the most comprehensive characterization of functional differences.

How does the beta-3 subunit modulate potassium activation of the Na+/K+-ATPase?

Research with Bufo marinus Na+/K+-ATPase has demonstrated that the beta-3 subunit specifically influences the potassium activation properties of the pump. When comparing pumps composed of alpha-1/beta-1 versus alpha-1/beta-3, significant differences in the K+ half-activation constant (K1/2) have been observed .

The methodology to investigate this modulatory effect typically involves:

  • Expression of defined subunit combinations: Co-expression of alpha-1 with either beta-1 or beta-3 in Xenopus oocytes.

  • K+ activation curves: Measuring pump current as a function of extracellular K+ concentration allows for determination of K1/2 values.

  • Chimeric and mutational analysis: Creating chimeric constructs between beta-1 and beta-3, or introducing specific mutations, can help identify the regions or residues responsible for the observed functional differences.

Research has shown that these differences in K+ activation are consistent across species, as similar results were obtained with Xenopus alpha-1 and beta-1 or beta-3 subunits and with Bufo/Xenopus heterodimers . This suggests that the modulatory effect of the beta subunit on K+ activation is a conserved feature that may have physiological significance.

The molecular mechanism underlying this modulation likely involves allosteric communication between the beta subunit and the K+ binding sites in the alpha subunit, potentially through conformational changes at the alpha-beta interface.

What evolutionary insights can be gained from studying the Bufo marinus Na+/K+-ATPase beta-3 subunit?

Evolutionary studies of the Na+/K+-ATPase beta-3 subunit across species can provide insights into the conservation of structure-function relationships and the adaptation of ion transport mechanisms to different physiological requirements.

Methodological approaches for evolutionary analysis include:

  • Phylogenetic analysis: Construction of evolutionary trees based on beta-3 sequences from diverse species to understand the evolutionary trajectory of this subunit.

  • Selection pressure analysis: Identification of conserved versus variable regions can reveal domains under different evolutionary constraints.

  • Structure-function correlation: Mapping of conserved residues onto structural models to identify functionally critical regions.

  • Environmental adaptation analysis: Correlation of sequence variations with environmental factors (e.g., salinity, temperature) to identify potential adaptations to different ecological niches.

The research finding that beta subunit isoforms modulate K+ activation differently across species boundaries suggests an evolutionarily conserved regulatory mechanism . This conservation implies functional importance and may reflect fundamental requirements for fine-tuning ion transport in different cellular contexts.

Additionally, studying amphibian Na+/K+-ATPase can provide insights into the adaptation of ion transport mechanisms during the evolutionary transition from aquatic to terrestrial environments, which involved significant challenges in osmoregulation and ion homeostasis.

How can chimeric constructs be designed to identify domains responsible for the functional differences between beta-1 and beta-3 subunits?

Chimeric construct approaches have been powerful tools for identifying functional domains within Na+/K+-ATPase subunits. Based on the observed functional differences between beta-1 and beta-3 in K+ activation , designing chimeras can help pinpoint the specific regions responsible for these differences.

Methodological approach:

  • Domain identification: Based on sequence alignment and structural information, identify discrete domains or regions that differ between beta-1 and beta-3 subunits.

  • Chimera design: Create a series of constructs where corresponding regions are exchanged between the two isoforms. This typically involves designing primers for overlap extension PCR or employing restriction enzyme-based cloning strategies.

  • Expression and functional characterization: Express the chimeric constructs with a partner alpha subunit and measure K+ activation parameters using electrophysiological techniques or ATPase activity assays.

  • Narrowing down functional regions: Based on initial results, design second-generation chimeras with smaller exchanged segments to further refine the identification of functional domains.

  • Site-directed mutagenesis: Once the region is narrowed down, individual residues can be mutated to identify specific amino acids responsible for the functional differences.

This approach can reveal which domains of the beta-3 subunit are responsible for its unique effect on K+ activation compared to beta-1, providing insights into the structural basis of functional modulation by beta subunits.

What are the technical challenges in crystallizing the full Na+/K+-ATPase complex containing the beta-3 subunit, and how can they be addressed?

Obtaining high-resolution structures of membrane protein complexes like the Na+/K+-ATPase presents significant challenges. While the search results don't specifically address crystallization of Bufo marinus Na+/K+-ATPase, the following methodological considerations would apply:

  • Protein production and purification:

    • Expression optimization: Identify expression systems that produce sufficient quantities of stable protein complex.

    • Purification strategy: Develop multi-step purification protocols that maintain the integrity of the alpha-beta complex.

    • Protein homogeneity: Employ methods such as size-exclusion chromatography to ensure sample homogeneity.

  • Crystallization challenges and solutions:

    • Detergent selection: Screen different detergents for their ability to maintain protein stability while promoting crystal contacts.

    • Lipid environment: Consider reconstitution into lipid nanodiscs or lipidic cubic phases to provide a more native-like environment.

    • Stabilizing mutations: Introduce mutations that enhance protein stability without affecting the structural features of interest.

    • Antibody-mediated crystallization: Use antibody fragments (Fab or nanobodies) to increase the hydrophilic surface area available for crystal contacts.

  • Alternative structural approaches:

    • Cryo-electron microscopy: For proteins recalcitrant to crystallization, single-particle cryo-EM has emerged as a powerful alternative.

    • Hybrid methods: Combine low-resolution structural data with computational modeling and biochemical constraints.

  • Conformational stabilization:

    • Use of inhibitors or substrate analogs to lock the enzyme in specific conformational states.

    • Cross-linking strategies to stabilize the alpha-beta interface.

Success in structural studies would provide invaluable insights into how the beta-3 subunit modulates the function of the Na+/K+-ATPase and the structural basis for the observed differences in K+ activation properties.

What is the physiological significance of having different beta subunit isoforms in various tissues?

The existence of multiple beta subunit isoforms, including beta-3, suggests distinct physiological roles that may be related to tissue-specific requirements for Na+/K+-ATPase function. While the search results don't provide specific information on the tissue distribution of Bufo marinus beta-3, research approaches to address this question would include:

  • Expression profiling: Analyze the expression patterns of different beta isoforms across tissues using techniques such as RT-PCR, in situ hybridization, or immunohistochemistry.

  • Correlation with physiological parameters: Correlate the expression of specific isoforms with tissue-specific ion transport requirements, membrane potential characteristics, or responses to hormonal regulation.

  • Knockout or knockdown studies: Examine the physiological consequences of reducing or eliminating specific beta isoforms in model systems.

The functional differences observed between beta-1 and beta-3 in terms of K+ activation properties suggest that tissues may fine-tune their Na+/K+-ATPase activity according to local requirements by regulating the expression of different beta isoforms. This could be particularly relevant in tissues where precise control of membrane potential or ion gradients is critical, such as neurons, kidney epithelial cells, or specialized secretory cells.

Additionally, the potential role of the beta subunit's extracellular domain in cell adhesion suggests that different isoforms might contribute to tissue-specific cell-cell interactions beyond their role in ion transport.

How might the differential K+ sensitivity conferred by beta-3 versus beta-1 impact cellular function in various physiological contexts?

The research on Bufo marinus Na+/K+-ATPase has demonstrated that pumps containing the beta-3 subunit have different K+ activation properties compared to those with beta-1 . This differential sensitivity has several potential physiological implications:

  • Adaptation to local K+ concentrations: Tissues exposed to varying extracellular K+ levels might preferentially express the beta isoform that provides optimal pump function under those conditions.

  • Response to K+ fluctuations: The different K1/2 values could result in differential responses to acute changes in extracellular K+, allowing for tissue-specific regulation of pump activity during physiological or pathological K+ fluctuations.

  • Energy efficiency: The K+ activation properties could influence the ATP consumption rate of the pump under various conditions, potentially optimizing energy utilization in different tissues.

  • Membrane potential regulation: By influencing the activity of the Na+/K+-ATPase at given K+ concentrations, the beta isoform composition could affect the contribution of the pump to the resting membrane potential.

Methodological approaches to investigate these implications would include:

  • Physiological measurements in native tissues: Compare ion transport, membrane potential, and responses to K+ changes in tissues with different beta isoform expression profiles.

  • Engineered expression systems: Create cell lines with controlled expression of specific alpha-beta combinations to study their functional properties in a cellular context.

  • Mathematical modeling: Develop computational models incorporating the kinetic parameters of different pump isoforms to predict their impact on cellular electrophysiology and ion homeostasis.

Understanding the physiological significance of beta isoform diversity could provide insights into both basic cell physiology and potential therapeutic approaches targeting specific Na+/K+-ATPase populations.

What are common pitfalls in the expression and purification of recombinant beta-3 subunit, and how can they be avoided?

Based on experience with similar membrane proteins, several challenges may arise when working with recombinant Na+/K+-ATPase beta-3 subunit:

  • Expression challenges:

    • Problem: Low expression levels

    • Solution: Optimize codon usage, promoter strength, and induction conditions; consider using expression tags that enhance protein production

    • Problem: Protein misfolding

    • Solution: Express at lower temperatures; co-express with chaperones; use folding-enhancing additives in the culture medium

    • Problem: Toxicity to host cells

    • Solution: Use tightly regulated expression systems; consider specialized expression strains designed for membrane proteins

  • Purification challenges:

    • Problem: Poor solubilization

    • Solution: Screen multiple detergents; optimize detergent:protein ratio and solubilization conditions; consider using newer amphipathic polymers (e.g., SMALPs) for native lipid co-extraction

    • Problem: Co-purification of contaminants

    • Solution: Develop multi-step purification protocols; use affinity tags positioned to minimize interference with protein function; employ ion exchange or size exclusion chromatography as polishing steps

    • Problem: Protein instability during purification

    • Solution: Include stabilizing agents (glycerol, specific lipids); maintain appropriate pH and ionic strength; minimize exposure to air/oxidation; work at reduced temperatures

  • Quality control:

    • Problem: Aggregation

    • Solution: Monitor by dynamic light scattering or size exclusion chromatography; optimize buffer conditions to minimize aggregation

    • Problem: Verifying proper folding

    • Solution: Use circular dichroism spectroscopy; assess binding of conformation-specific antibodies or ligands; verify ability to form complex with alpha subunit

These methodological considerations are crucial for obtaining high-quality recombinant protein suitable for structural and functional studies.

How can researchers distinguish between endogenous and recombinant Na+/K+-ATPase activity in experimental systems?

When studying recombinant Na+/K+-ATPase in various expression systems, differentiating the activity of the introduced pump from endogenous activity is critical for accurate interpretation of results. The research on Bufo marinus Na+/K+-ATPase provides an excellent example of a methodological approach to address this challenge:

  • Exploiting differential ouabain sensitivity: The researchers took advantage of the relative resistance to ouabain conferred by the Bufo alpha subunit to study specifically the exogenously expressed Na+/K+ pumps after inhibition of the ouabain-sensitive endogenous Xenopus Na+/K+ pumps . This approach allowed them to selectively measure the activity of the recombinant pump.

  • Additional methodological approaches:

    • Genetic manipulation: Using expression systems with knockout or knockdown of endogenous pump subunits

    • Epitope tagging: Adding detectable tags to recombinant subunits to allow specific isolation or detection

    • Species-specific antibodies: Using antibodies that recognize only the recombinant (or only the endogenous) pump components

    • Kinetic discrimination: Exploiting differences in kinetic parameters between endogenous and recombinant pumps

  • Quantitative considerations:

    • Overexpression strategy: Expressing recombinant pump at levels significantly higher than endogenous pump

    • Background subtraction: Measuring activity in control cells (without recombinant expression) to determine the endogenous component

  • Validation approaches:

    • Correlation between protein expression and activity: Demonstrating that activity levels correlate with the expression level of the recombinant protein

    • Mutagenesis effects: Showing that mutations in the recombinant protein affect the measured activity in predicted ways

These methodological considerations are essential for ensuring the validity of functional studies with recombinant Na+/K+-ATPase and can be applied to various experimental systems depending on the specific research question.

What are promising approaches for investigating the role of beta-3 in cellular physiology beyond its function in the Na+/K+-ATPase complex?

The beta-3 subunit may have functions beyond its role in Na+/K+-ATPase activity, particularly given the indication that its C-terminal lobe may mediate cell adhesion properties . Several methodological approaches could be employed to investigate these additional roles:

  • Protein interaction studies:

    • Co-immunoprecipitation followed by mass spectrometry to identify novel interaction partners

    • Yeast two-hybrid or mammalian two-hybrid screening

    • Proximity labeling techniques (BioID, APEX) to identify neighboring proteins in the cellular context

  • Cell adhesion and migration assays:

    • Cell aggregation assays to assess homophilic or heterophilic adhesion properties

    • Wound healing or transwell migration assays to examine potential roles in cell motility

    • Atomic force microscopy to measure adhesion forces at the single-molecule level

  • Domain-specific functional studies:

    • Expression of the extracellular domain as a soluble protein to test for adhesion or signaling functions

    • Creation of chimeric proteins where the adhesion domain is fused to reporter systems

    • Competition assays using soluble domains or peptides derived from beta-3

  • Tissue-specific knockout models:

    • CRISPR/Cas9-mediated deletion of beta-3 in specific tissues or cell types

    • Rescue experiments with various beta-3 constructs to dissect domain-specific functions

    • Analysis of phenotypes related to cell adhesion, tissue architecture, or signaling pathways

These approaches could reveal novel functions of the beta-3 subunit and contribute to our understanding of how this protein participates in cellular processes beyond ion transport.

How might understanding beta subunit function contribute to the development of targeted therapies for diseases involving Na+/K+-ATPase dysfunction?

The Na+/K+-ATPase is implicated in various pathological conditions, including cardiovascular diseases, neurological disorders, and cancer. Understanding the specific contributions of beta subunits, including beta-3, could lead to more targeted therapeutic approaches:

  • Isoform-specific targeting:

    • Development of compounds that selectively modulate pumps containing specific beta isoforms

    • Design of peptides or small molecules that interact with the unique regions of beta-3

    • Use of antisense oligonucleotides or siRNAs for isoform-specific knockdown in tissues where beta-3 dysfunction contributes to pathology

  • Targeting beta subunit interactions:

    • Development of compounds that specifically modulate the alpha-beta interaction in a manner that affects function

    • Targeting of beta-3-mediated cell adhesion interactions if these contribute to disease processes

  • Exploiting beta subunit polymorphisms:

    • Identification of genetic variants in beta-3 that correlate with disease susceptibility or progression

    • Development of personalized approaches based on patient-specific beta subunit genetics

  • Methodological approaches for drug discovery:

    • High-throughput screening using cell lines expressing specific alpha-beta combinations

    • Structure-based drug design targeting beta-3-specific pockets or interfaces

    • In silico screening followed by validation in cell and animal models

  • Biomarker potential:

    • Assessment of beta-3 expression or modification patterns as diagnostic or prognostic markers

    • Monitoring of beta-3 autoantibodies or circulating fragments in certain conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.