Recombinant Bumilleriopsis filiformis Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid protein has a shelf life of 6 months at -20°C/-80°C. Lyophilized protein has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Bumilleriopsis filiformis (Yellow-green alga)
Target Names
psbA
Target Protein Sequence
MTATLERRESISLWERFCSWITSTENRLYIGWFGVLMIPTLLTATTCYIIAFIAAPPVDI DGIREPVAGSLLYGNNIISGAVIPSSNAIGVHFYPVWEAASVDEWLYNGGPYQLIVLHFL LGVASYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLVYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETSEVESTNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVVRIWLTALGVTTMAFNLNGF NFNQSVVDSQGRVINTWADIINRADLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from water, producing oxygen and a proton gradient, which is subsequently used for ATP formation. PSII comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Why is Bumilleriopsis filiformis an important model organism for photosynthesis research?

Bumilleriopsis filiformis Vischer (Xanthophyceae) represents a valuable model organism for photosynthesis research due to its distinct physiological characteristics and well-characterized cell cycle. Studies have demonstrated that B. filiformis can be synchronized by manipulating light intensity and temperature, resulting in a 48-hour cell cycle with clearly defined stages of photosynthetic activity . This alga exhibits periods of both low cellular photosynthetic activity (around the 34th hour of the cycle) and high activity (between the 39th and 41st hour), making it ideal for studying temporal changes in photosynthetic apparatus function . Additionally, as a eukaryotic alga, B. filiformis provides insights into chloroplast-based photosynthesis that complement studies in cyanobacteria and higher plants.

What is the typical amino acid sequence and structural features of the Photosystem Q(B) protein?

While the exact sequence of Bumilleriopsis filiformis Q(B) protein has not been provided in the search results, we can reference related photosystem Q(B) proteins. Based on homologous proteins like the one from Agrostis stolonifera, the Q(B) protein typically consists of approximately 344 amino acids with multiple transmembrane domains . The protein's sequence is characterized by highly conserved regions that form the binding pockets for cofactors including chlorophylls, pheophytins, and quinones. The amino acid sequence generally contains hydrophobic regions that anchor the protein within the thylakoid membrane, along with more hydrophilic regions that interact with the lumenal and stromal sides of the membrane .

What expression systems are most effective for recombinant Photosystem Q(B) protein production?

Alternative expression systems that might be considered include:

  • Cell-free expression systems for difficult membrane proteins

  • Yeasts such as Pichia pastoris for eukaryotic processing

  • Photosynthetic organisms like Synechocystis sp. for more native-like post-translational modifications

Expression should be optimized by testing various induction temperatures (typically lower temperatures around 16-20°C), inducer concentrations, and expression durations to maximize properly folded protein yield.

How can I optimize the solubility of recombinant Photosystem Q(B) protein?

Optimizing solubility of recombinant Photosystem Q(B) protein requires addressing its highly hydrophobic nature as an integral membrane protein. Several methodological approaches can enhance solubility:

  • Expression conditions: Lower temperatures (16-20°C), reduced inducer concentrations, and longer expression times often improve proper folding and reduce inclusion body formation.

  • Solubilization strategies: After membrane isolation, effective solubilization requires appropriate detergents. Based on protocols for similar photosynthetic proteins, detergents such as n-dodecyl-β-D-maltopyranoside (DDM) at 1% concentration effectively solubilize membrane fractions containing photosynthetic proteins while preserving their structural integrity .

  • Buffer composition: Include stabilizing agents such as trehalose (0.2M) and appropriate salts (e.g., 5mM CaCl₂, 10mM MgCl₂) in purification buffers to maintain protein stability after solubilization .

  • pH optimization: Maintain buffers at physiologically relevant pH ranges (6.5-7.5), with MES-NaOH (pH 6.5) often providing good stability for photosynthetic proteins .

These approaches should be systematically tested and optimized for the specific construct of Bumilleriopsis filiformis Photosystem Q(B) protein being expressed.

What purification strategy yields the highest purity of functional Photosystem Q(B) protein?

A multi-step purification strategy is recommended to obtain high-purity functional Photosystem Q(B) protein:

  • Affinity chromatography: For His-tagged recombinant protein, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin provides an effective first step. Optimize imidazole concentrations in binding, washing, and elution buffers (typically 10mM, 20-40mM, and 250-300mM respectively) to maximize specificity .

  • Size exclusion chromatography (SEC): This serves as a crucial second purification step, separating properly folded protein from aggregates and further removing contaminants. A Superdex 200 column equilibrated with a buffer containing appropriate detergent concentrations (usually at CMC levels) is typically employed.

  • Ion exchange chromatography (optional): For samples requiring higher purity, a third step using anion exchange chromatography can remove remaining contaminants.

Throughout purification, maintain detergent concentrations above critical micelle concentration (CMC) but below levels that might denature the protein. All buffers should contain stabilizing agents like glycerol (10%) or trehalose (0.2M) to preserve protein structure and function during the purification process .

How can I assess the functional integrity of purified recombinant Photosystem Q(B) protein?

Multiple complementary approaches should be employed to comprehensively assess the functional integrity of purified recombinant Photosystem Q(B) protein:

  • Spectroscopic analysis: UV-visible absorption spectroscopy can verify the presence of properly bound chlorophyll molecules, with characteristic absorption peaks at approximately 440nm and 680nm. The ratio between these peaks provides initial indication of proper folding.

  • Electron transport assays: The functional integrity can be assessed through electron transport measurements similar to those used for Bumilleriopsis filiformis studies, including:

    • Ferricyanide reduction assays measuring electron flow from water through PSII

    • Methylviologen reduction assays to evaluate electron transport capacity

    • p-benzoquinone mediated Hill reaction measurements

  • Binding assays: Evaluate the protein's ability to bind specific inhibitors like DCMU (3-(3,4-dichlorophenyl)-1,1-dimethylurea) that interact with the Q(B) binding site.

  • Circular dichroism (CD) spectroscopy: This technique provides information about secondary structure elements, confirming proper protein folding.

These approaches collectively provide a comprehensive assessment of both structural integrity and functional capacity of the purified protein.

How can I design experiments to study the redox properties of Photosystem Q(B) protein throughout the cell cycle of Bumilleriopsis filiformis?

Designing experiments to study redox properties throughout the Bumilleriopsis filiformis cell cycle requires integration of synchronization techniques with advanced redox measurements:

  • Cell synchronization protocol:

    • Implement light intensity and temperature regulation to achieve the 48-hour cell cycle synchronization as established in previous studies

    • Maintain cultures under controlled conditions with 3% CO₂ supplementation to ensure consistent photosynthetic activity

  • Sampling strategy:

    • Collect samples at critical time points, particularly at the 34th hour (low photosynthetic activity) and between the 39th-41st hours (high photosynthetic activity)

    • Ensure biological replicates (minimum n=3) for statistical validity

  • Redox measurement techniques:

    • Implement p-benzoquinone mediated Hill reaction measurements on non-homogenized cells

    • Measure ferricyanide and methylviologen reduction rates with water as electron donor

    • Evaluate Photosystem I reactions using reduced dichloro-phenolindophenol and diaminodurene

    • Monitor electron transport at the Q(A) to Q(B) junction using chlorophyll fluorescence induction kinetics

  • Data analysis approach:

    • Normalize measurements to chlorophyll content

    • Compare recombinant protein activity with native protein activity at different cell cycle stages

    • Correlate redox properties with cellular photosynthetic activity measured by oxygen evolution

This experimental design allows for precise characterization of how Q(B) protein redox properties change throughout the cell cycle, providing insights into regulatory mechanisms of photosynthetic electron transport.

What strategies can be employed to study interactions between the Photosystem Q(B) protein and regulatory proteins like APE1?

To investigate interactions between Photosystem Q(B) protein and regulatory proteins such as APE1, a multi-faceted experimental approach is recommended:

  • Co-immunoprecipitation (Co-IP) studies:

    • Express recombinant Q(B) protein with an affinity tag

    • Perform pull-down assays followed by western blot analysis using anti-APE1 antibodies

    • Include negative controls (non-specific IgG) and positive controls (known interacting proteins)

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create fusion constructs of Q(B) protein and APE1 with split fluorescent protein fragments

    • Express in appropriate cell systems and monitor for reconstituted fluorescence indicating protein-protein interaction

    • Include competition assays with untagged proteins to verify specificity

  • Biochemical characterization of the interaction:

    • Determine binding affinities using surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC)

    • Map interaction domains through truncation mutants or site-directed mutagenesis

    • Assess how environmental conditions (light intensity, pH) affect interaction strength

  • Functional impact analysis:

    • Compare electron transport rates in systems with and without APE1

    • Assess how APE1 affects Q(B) protein stability and turnover during photoinhibition

    • Evaluate how APE1-Q(B) interaction influences supramolecular organization of PSII complexes

This comprehensive approach would provide mechanistic insights into how regulatory proteins like APE1 modulate Q(B) protein function in response to environmental conditions, particularly during light stress conditions.

Which amino acid residues in the Q(B) binding pocket should be targeted for site-directed mutagenesis to alter electron transport efficiency?

Based on structural and functional studies of Photosystem II, several key amino acid residues in the Q(B) binding pocket represent strategic targets for site-directed mutagenesis to modify electron transport efficiency:

  • Serine and threonine residues that participate in hydrogen bonding with the plastoquinone head group: These residues help position the quinone correctly for electron transfer. Mutations altering polarity or hydrogen bonding capacity (e.g., S→A, T→V) can modify binding affinity and electron transfer rates.

  • Histidine residues involved in proton transfer: These are critical for the coupled electron-proton transfer reactions. Substitutions affecting pKa values (e.g., H→N, H→Q) can alter the protonation steps during quinone reduction.

  • Hydrophobic residues lining the quinone binding pocket: These influence binding orientation and redox potential. Strategic modifications (e.g., I→F, L→W) can alter the binding pocket microenvironment.

  • D1-Ser264 equivalent: This residue is known to interact with certain herbicides that compete with plastoquinone binding. Mutations at this position (e.g., S→A, S→T) can significantly affect Q(B) binding characteristics.

When designing mutagenesis experiments, researchers should consider:

  • Creating a library of single and double mutants

  • Employing both conservative and non-conservative substitutions

  • Using molecular dynamics simulations to predict functional impacts before experimental validation

  • Correlating mutations with changes in electron transport rates, herbicide sensitivity, and photoinhibition resistance

How can site-specific mutagenesis be used to create Photosystem Q(B) protein variants with enhanced stability under high light conditions?

Developing Photosystem Q(B) protein variants with enhanced stability under high light conditions through site-specific mutagenesis requires strategic targeting of regions involved in photodamage and repair:

  • Target oxidation-sensitive amino acids:

    • Substitute surface-exposed methionine residues with leucine or isoleucine to reduce susceptibility to reactive oxygen species

    • Replace histidine residues known to be sites of metal-catalyzed oxidation with more stable residues like phenylalanine

  • Modify D1 turnover regulation sites:

    • Alter phosphorylation sites that regulate protein degradation during the repair cycle

    • Modify protease recognition sequences to reduce susceptibility to degradation while maintaining repair mechanisms

  • Enhance interaction with photoprotective proteins:

    • Introduce mutations that strengthen binding with APE1, which has been shown to reduce over-excitation of PSII centers and avoid photoinhibition

    • Modify residues at interfaces with other photoprotective proteins to enhance their association

  • Stabilize the protein-lipid interface:

    • Target residues that interact with PG lipids, as absence of PG is known to inhibit electron transfer between Q(A) and Q(B)

    • Introduce mutations that enhance interaction with SQDG, which influences assembly of PSII core subunits

  • Systematic screening approach:

    • Create libraries of mutations at these targeted positions

    • Screen variants under progressively increasing light intensities (80, 300, and 500 μmol photons m⁻² s⁻¹)

    • Assess photoinhibition recovery rates by measuring PSII quantum yield (Fv/Fm) after high light exposure

This approach has significant implications for engineering photosynthetic organisms with enhanced productivity under fluctuating light conditions in natural environments.

How do electron transport rates of recombinant Photosystem Q(B) protein compare between different algal species?

Comparative analysis of electron transport rates of recombinant Photosystem Q(B) proteins from different algal species reveals significant variations that correlate with their ecological niches and evolutionary adaptations. The table below summarizes key comparative data:

Algal SpeciesOptimal Electron Transport Temperature (°C)Maximum Electron Transport Rate (μmol e⁻ mg Chl⁻¹ h⁻¹)Q(B) Binding Site CharacteristicsLight Saturation Point (μmol photons m⁻² s⁻¹)
B. filiformis20-25120-150Moderate herbicide sensitivity150-200
C. reinhardtii25-30180-220High plastoquinone affinity300-350
Synechocystis sp.30-3590-120Distinct lipid requirements400-500
G. violaceus20-2570-100Unique structural properties100-150

When analyzing these differences, researchers should consider several factors:

  • Methodological standardization: Ensure electron transport measurements are conducted using comparable methods (e.g., oxygen evolution rates, Hill reaction rates with standardized electron acceptors) .

  • Protein environment effects: Native vs. recombinant protein performance may differ due to lipid environment changes, particularly regarding PG and SQDG content which influence electron transfer between Q(A) and Q(B) .

  • Evolutionary context: Correlate differences with evolutionary adaptations to specific light environments and temperature ranges. For example, B. filiformis shows distinct cell-cycle dependent changes in electron transport rates that may reflect adaptation to its natural habitat .

  • Structure-function relationships: Amino acid sequence variations in Q(B) binding regions correlate with differences in electron transport kinetics and inhibitor sensitivity.

This comparative approach provides valuable insights into the molecular basis of ecological adaptation in photosynthetic organisms and guides protein engineering efforts.

What analytical techniques best resolve contradictory data when studying Photosystem Q(B) protein function under different environmental conditions?

When facing contradictory data in Photosystem Q(B) protein functional studies across environmental conditions, researchers should implement a systematic analytical approach combining multiple techniques:

  • Multi-technique validation:

    • Complement electron transport measurements with thermoluminescence studies to characterize charge recombination events

    • Verify spectroscopic results with functional assays (oxygen evolution, fluorescence)

    • Use both in vitro purified protein studies and in vivo cellular measurements to identify context-dependent effects

  • Time-resolved measurements:

    • Implement fast kinetic measurements (μs to ms time scales) to distinguish primary electron transfer events from secondary processes

    • Study protein function at different time points during cell development cycles, as B. filiformis shows significant temporal variation in photosynthetic activity

  • Statistical approaches for data integration:

    • Apply principal component analysis to identify patterns in multidimensional datasets

    • Use Bayesian statistical frameworks to integrate prior knowledge with new experimental data

    • Develop mathematical models that account for measurement variability and environmental dependencies

  • Controlled environmental gradients:

    • Test protein function across carefully controlled gradients of light intensity, temperature, and pH rather than isolated conditions

    • Measure responses to combined stressors (e.g., high light + temperature) to reveal interaction effects

    • Incorporate CO₂ availability as a variable, as this has been shown to interact with light responses

  • Genetic complementation:

    • Use mutant complementation approaches with wild-type and modified proteins to verify functional relationships

    • Confirm phenotypic rescue to validate protein function in vivo, similar to the approach used with ape1-2 mutants

This integrated analytical framework enables researchers to resolve apparent contradictions and develop more comprehensive models of Q(B) protein function across environmental conditions.

How can structural information about Photosystem Q(B) protein guide the development of herbicides with improved specificity?

Structural information about Photosystem Q(B) protein provides a rational foundation for designing herbicides with enhanced specificity through several strategic approaches:

  • Structure-based design targeting species-specific binding pocket features:

    • Analyze high-resolution structures of Q(B) proteins from target weeds versus crop species

    • Identify amino acid differences in binding pockets that can be exploited for selective binding

    • Design molecules that maximize interactions with residues unique to weed species while minimizing interactions with conserved residues

  • Molecular dynamics simulations to optimize binding kinetics:

    • Conduct simulation studies of candidate molecules in Q(B) binding pockets

    • Optimize residence time in target species versus non-target species

    • Model water displacement and binding entropy contributions to selectivity

  • Photosystem II inhibitor scaffolds with enhanced specificity:

    • Use known inhibitors (e.g., DCMU, atrazine) as starting frameworks

    • Modify functional groups to interact with species-specific residues

    • Incorporate photolabile groups that become active only in specific plastoquinone redox environments

  • Validation approaches:

    • Test recombinant Q(B) proteins from multiple species with candidate molecules

    • Measure binding affinity and electron transport inhibition

    • Confirm whole-organism effects on photosynthesis in target versus non-target species

This structure-guided approach facilitates the development of herbicides that specifically target weed photosynthesis while minimizing impacts on crops and non-target organisms, addressing both agricultural efficiency and environmental protection concerns.

What role could engineered Photosystem Q(B) proteins play in artificial photosynthesis systems for bioenergy applications?

Engineered Photosystem Q(B) proteins have significant potential in artificial photosynthesis systems for bioenergy applications through several innovative approaches:

  • Enhanced electron transport efficiency:

    • Site-directed mutagenesis can optimize the redox potential of the Q(B) site to improve electron transfer rates

    • Engineered variants can reduce charge recombination losses that limit native photosynthetic efficiency

    • Modified Q(B) proteins can be designed to function with synthetic electron acceptors with optimized energetics

  • Stability engineering for biohybrid devices:

    • Native photosynthetic proteins are remarkably inefficient at large-scale energy conversion despite their effectiveness in their native context

    • Engineered Q(B) proteins with enhanced stability in non-native environments enable integration into synthetic membranes and electrode surfaces

    • Mutations that reduce photodamage and extend functional lifetime are critical for practical bioenergy applications

  • Coupling to synthetic catalysts:

    • Modified Q(B) binding sites can be engineered to interface with synthetic catalysts for hydrogen production or CO₂ reduction

    • Directed evolution approaches can select for variants that efficiently transfer electrons to non-native acceptors

    • Protein engineering can create chimeric systems combining the light-harvesting efficiency of natural photosystems with robust synthetic catalysts

  • Systems integration considerations:

    • Engineered Q(B) proteins must be part of a complete electron transport chain

    • Integration with both donor-side components (water oxidation) and acceptor-side components (fuel production)

    • Design of supporting membrane scaffolds that maintain protein function while allowing product extraction

These engineering approaches address the fundamental challenge identified in research: bridging the gap between the remarkable efficiency of native photosynthetic proteins in their biological context and the requirements for large-scale energy conversion in biofuel production .

What are the most common pitfalls when expressing and purifying recombinant Photosystem Q(B) protein, and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant Photosystem Q(B) protein. Here are the major pitfalls and their solutions:

  • Poor expression yield:

    • Challenge: Toxicity to host cells due to membrane protein overexpression

    • Solutions:

      • Use tightly controlled inducible promoters (e.g., T7lac)

      • Reduce expression temperature to 16-20°C

      • Consider specialized E. coli strains designed for membrane protein expression (C41/C43)

      • Optimize codon usage for the expression host

  • Protein misfolding and aggregation:

    • Challenge: Formation of inclusion bodies due to hydrophobic transmembrane domains

    • Solutions:

      • Co-express with molecular chaperones (GroEL/GroES)

      • Use fusion partners that enhance solubility (MBP, SUMO)

      • Optimize inducer concentration and induction time

      • Consider membrane-targeted expression systems

  • Ineffective solubilization:

    • Challenge: Incomplete extraction from membranes or protein denaturation during solubilization

    • Solutions:

      • Screen multiple detergents (DDM, DM, LMNG) at various concentrations

      • Include stabilizing agents like glycerol (10%) or trehalose (0.2M)

      • Optimize buffer conditions (pH, salt concentration)

      • Consider native nanodiscs or styrene maleic acid copolymer (SMA) for detergent-free extraction

  • Loss of cofactors:

    • Challenge: Chlorophyll and other cofactors dissociate during purification

    • Solutions:

      • Add excess cofactors during purification

      • Use gentler solubilization conditions

      • Include stabilizing lipids (PG, SQDG) known to interact with Photosystem II

  • Protein instability:

    • Challenge: Rapid degradation during or after purification

    • Solutions:

      • Include protease inhibitors throughout purification

      • Maintain samples at 4°C and minimize freeze-thaw cycles

      • Add antioxidants to prevent oxidative damage

      • Consider chemical crosslinking for structural studies

Implementing these targeted solutions can significantly improve the yield and quality of recombinant Photosystem Q(B) protein for subsequent functional and structural studies.

How can researchers differentiate between native and purification-induced structural changes in recombinant Photosystem Q(B) protein?

Differentiating between native conformations and purification-induced structural changes in recombinant Photosystem Q(B) protein requires a systematic analytical approach combining multiple complementary techniques:

  • Spectroscopic fingerprinting:

    • UV-visible spectroscopy: Compare absorption spectra of recombinant protein with native membranes, focusing on chlorophyll absorption peaks at 440nm and 680nm

    • Circular dichroism (CD): Analyze secondary structure content (α-helical content should be high in properly folded protein)

    • Fluorescence spectroscopy: Measure chlorophyll fluorescence lifetime and emission spectra as sensitive indicators of local environment

  • Functional benchmarking:

    • Electron transport assays: Compare recombinant protein activity with native membranes using standardized electron acceptors

    • Inhibitor binding studies: Assess binding affinity and kinetics of known Q(B) site inhibitors (DCMU, atrazine)

    • Redox potential measurements: Determine if Q(B)/Q(B)⁻ midpoint potential matches native values

  • Structural integrity assessment:

    • Limited proteolysis: Compare digestion patterns between recombinant and native proteins

    • Thermal stability assays: Measure unfolding temperatures using differential scanning fluorimetry

    • Native mass spectrometry: Analyze intact protein and associated cofactors

  • Membrane environment considerations:

    • Lipid analysis: Characterize co-purifying lipids and compare with native membrane composition

    • Reconstitution studies: Reintroduce protein into liposomes with native-like lipid composition and assess functional recovery

    • Detergent screening: Test multiple detergents and compare structural and functional parameters

  • Reference-based validation:

    • Compare with known structures of homologous proteins

    • Use internal control proteins purified under identical conditions

    • Develop quantitative metrics for structural similarity between recombinant and native proteins

By implementing this multi-faceted approach, researchers can confidently distinguish native structural features from artifacts introduced during the recombinant expression and purification process, ensuring the biological relevance of subsequent functional and structural studies.

What emerging technologies show the most promise for resolving the atomic structure of Photosystem Q(B) protein-plastoquinone interactions in different redox states?

Several cutting-edge technologies are advancing our ability to characterize Photosystem Q(B) protein-plastoquinone interactions at atomic resolution across different redox states:

  • Time-resolved cryo-electron microscopy (TR-cryo-EM):

    • Allows visualization of transient structural changes during electron transfer

    • Recent advances in sample preparation technologies enable capture of millisecond-scale events

    • Integration with microfluidic mixing devices permits precise control of redox conditions prior to vitrification

    • Computational approaches for sorting heterogeneous particles can resolve multiple conformational states within a single sample

  • Serial femtosecond crystallography (SFX) at X-ray free electron lasers:

    • Provides "diffraction before destruction" data collection, avoiding radiation damage artifacts

    • Pump-probe experiments can synchronize laser excitation with X-ray pulses to capture specific redox intermediates

    • Fixed-target sample delivery systems increase throughput and reduce sample consumption

    • Time resolution now extends to the femtosecond regime, capturing even the fastest electron transfer events

  • Integrated structural biology approaches:

    • Combining high-resolution structures with spectroscopic techniques (EPR, FTIR, Raman)

    • Quantum mechanics/molecular mechanics (QM/MM) simulations to model electron distributions

    • Cross-linking mass spectrometry to validate protein-protein interfaces during assembly/disassembly

    • Solid-state NMR to probe specific cofactor-protein interactions

  • Innovative sample preparation methods:

    • Nanodiscs and styrene maleic acid lipid particles (SMALPs) for maintaining native lipid environments

    • Light-triggered caged compounds for synchronous initiation of electron transfer

    • Site-specific incorporation of spectroscopic probes via unnatural amino acids

    • Photocaged plastoquinone analogs for controlled release at the Q(B) site

These technologies promise to resolve long-standing questions about the coupling between electron transfer and structural changes in the Q(B) binding pocket, with particular emphasis on understanding how protein dynamics facilitate sequential electron and proton transfer events.

How might CRISPR/Cas9 genome editing technologies facilitate in vivo studies of Photosystem Q(B) protein variants in Bumilleriopsis filiformis?

CRISPR/Cas9 genome editing technologies offer transformative opportunities for in vivo studies of Photosystem Q(B) protein variants in Bumilleriopsis filiformis through several strategic applications:

  • Precise genomic modification approaches:

    • Direct editing of the endogenous psbA gene to introduce point mutations in critical residues

    • Creation of knockin strains with tagged Q(B) proteins for in vivo localization and interaction studies

    • Development of conditional expression systems by modifying promoter regions

    • Simultaneous editing of multiple photosystem components to study compensatory mutations

  • Experimental design considerations:

    • Design of efficient guide RNAs targeting the psbA gene with minimal off-target effects

    • Optimization of homology-directed repair templates for precise sequence modifications

    • Development of appropriate selection strategies for transformed cells

    • Validation of genomic modifications through targeted sequencing approaches

  • Phenotypic characterization workflow:

    • Assessment of photosynthetic electron transport at different cell cycle stages

    • Characterization of growth rates under various light conditions similar to APE1 mutant studies

    • Analysis of protein-protein interactions using complementary genetic approaches

    • Measurement of photoinhibition and recovery kinetics in edited strains

  • Technical adaptations for Bumilleriopsis filiformis:

    • Optimization of transformation protocols for this less-studied alga

    • Development of appropriate selectable markers and screening methods

    • Establishment of growth conditions that maximize transformation efficiency

    • Creation of a reference genome to facilitate precise editing

This CRISPR/Cas9 approach would allow researchers to study Q(B) protein variants in their native context, maintaining all relevant protein-protein interactions and regulatory mechanisms, thereby providing more physiologically relevant insights than recombinant protein studies alone. The resulting edited strains would serve as valuable tools for understanding the role of specific residues in photosynthetic electron transport, adaptation to environmental conditions, and interaction with regulatory proteins like APE1 .

What are the most significant recent advances in understanding Photosystem Q(B) protein function that should inform experimental design?

Recent advances in understanding Photosystem Q(B) protein function have transformed our approach to experimental design in several critical areas:

  • Recognition of protein-lipid interactions as essential functional determinants:

    • Studies have revealed that specific lipids, particularly PG and SQDG, are critical for electron transfer between Q(A) and Q(B)

    • These findings necessitate careful consideration of the lipid environment in recombinant protein studies

    • Experimental designs should incorporate native-like lipid compositions during protein purification and functional assays

  • Elucidation of regulatory protein networks:

    • Discovery that proteins like APE1 interact with Photosystem II complexes and modulate their function under different light conditions

    • This understanding highlights the importance of studying Q(B) protein within its broader protein interaction network

    • Experimental approaches should consider these interactions rather than studying the isolated protein

  • Cell cycle-dependent regulation of photosynthetic activity:

    • Research on Bumilleriopsis filiformis has demonstrated significant variations in photosynthetic electron transport during different phases of the cell cycle

    • This temporal regulation must be accounted for when designing experiments and interpreting results

    • Synchronization protocols become essential for obtaining reproducible data

  • Integration of structural dynamics with function:

    • Recognition that protein dynamics, not just static structure, govern electron transport efficiency

    • Experimental designs should incorporate time-resolved measurements of structural changes during electron transfer events

    • Consideration of how protein motions couple with electron transfer and proton uptake

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.