Recombinant Burkholderia ambifaria 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Ubiquinone Biosynthesis

UbiA is indispensable for ubiquinone production, which facilitates electron transport in aerobic respiration and acts as an antioxidant . Key functional insights include:

  • Substrate Flexibility: While specific to PHB, UbiA accommodates isoprenyl diphosphates of varying lengths (C10–C45) .

  • Low Affinity for Short Chains: The Kₘ for geranyl diphosphate (C10) is 0.2 mM, increasing with longer substrates like solanesyl diphosphate (C45) .

Disease Relevance:
Mutations in eukaryotic UbiA homologs (e.g., COQ2) are linked to severe mitochondrial disorders, underscoring the enzyme’s conserved role in energy metabolism .

Production and Recombinant Applications

Expression Systems:

SystemAdvantagesYieldSource
E. coliCost-effective, high scalability0.1–1.0 mg/mL
BaculovirusPost-translational modifications, higher purity>85% purity

Applications:

  • Biocontrol Agent Development: B. ambifaria strains harboring UbiA are explored as biopesticides due to antifungal activity and plant-growth-promoting traits .

  • Enzyme Engineering: Used to study prenyltransferase mechanisms and design inhibitors targeting pathogenic microbes .

Research Advancements

Recent studies highlight:

  • Structural Insights: Crystal structures of archaeal UbiA homologs reveal a unique substrate-binding cavity stabilized by transmembrane helices, enabling catalysis within lipid bilayers .

  • Genomic Context: The ubiA gene in B. ambifaria is part of conserved operons involved in ubiquinone and menaquinone biosynthesis, often co-regulated with stress-response pathways .

Ongoing Challenges:

  • Instability: Repeated freeze-thaw cycles degrade activity, necessitating single-use aliquots .

  • Substrate Specificity: Engineering UbiA for industrial-scale polyprenol production remains limited by its preference for PHB .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiA; BamMC406_0645; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Burkholderia ambifaria (strain MC40-6)
Target Names
ubiA
Target Protein Sequence
MLARFPLYLRLVRMDKPIGSLLLLWPTLNALWIASDGHPRWPLLAIFALGTLLMRSAGCA MNDYADRDFDRHVKRTADRPLTSGKIRAWEAVAIAVVLAFISFLLIQPLNTLTKELSVVA LFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPMLAWVMLIANIFWSVAYDT EYAMVDRDDDIKIGIRTSALTFGRFDVAAVMLCYAATLGIYVWIGVTLGFGLAYWAGWAA AVGCALYHYTLIKDRERMPCFAAFRHNNWLGGVLFAGIAAHYLLAGTAGN
Uniprot No.

Target Background

Function
Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. This enzyme mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia ambifaria 4-hydroxybenzoate octaprenyltransferase (ubiA)?

Burkholderia ambifaria 4-hydroxybenzoate octaprenyltransferase (ubiA) is a membrane-embedded enzyme belonging to the UbiA family of prenyltransferases. This enzyme catalyzes the Mg²⁺-dependent transfer of a hydrophobic polyprenyl chain onto acceptor molecules, specifically 4-hydroxybenzoate, as a critical step in ubiquinone (Coenzyme Q) biosynthesis . The protein from Burkholderia ambifaria strain MC40-6 has UniProt accession number B1YTH7 and is encoded by the ubiA gene (BamMC406_0645) .

The enzyme is also known as 4-HB polyprenyltransferase with an EC classification of 2.5.1.- . The full-length protein consists of 290 amino acid residues with a specific sequence beginning with mLARFPLYLRLVRMDKPIGS and continuing through to the C-terminal region .

What is the functional significance of UbiA prenyltransferases in bacterial systems?

UbiA family prenyltransferases play crucial roles in the biosynthesis of molecules that mediate electron transport, including Vitamin K and Coenzyme Q (ubiquinone) . These enzymes catalyze a key step in the ubiquinone biosynthetic pathway by transferring a prenyl group to 4-hydroxybenzoate.

The reaction mechanism involves:

  • Binding of Mg²⁺ within the catalytic site

  • Coordination of the isoprenyl diphosphate substrate

  • Transfer of the prenyl group to the acceptor molecule

  • Release of pyrophosphate as a leaving group

This reaction occurs within a sealed amphipathic chamber inside the protein, which protects the reaction intermediate from the solvent environment . The resulting prenylated products are essential components of electron transport chains in the bacterial membrane, making ubiA essential for cellular respiration and energy production.

How is Burkholderia ambifaria taxonomically characterized?

Burkholderia ambifaria was established as a distinct species through a comprehensive polyphasic taxonomic study. The characterization included:

  • Amplified fragment length polymorphism (AFLP) fingerprinting

  • DNA-DNA hybridizations

  • DNA base-ratio determinations

  • Phylogenetic analysis

  • Whole-cell fatty acid analyses

  • Extensive biochemical characterization

B. ambifaria is part of the Burkholderia cepacia complex (Bcc), a group of closely related species with significant clinical and agricultural importance. The type strain is LMG 19182T . B. ambifaria can be differentiated from other members of the B. cepacia complex through:

  • AFLP fingerprinting patterns

  • Whole-cell fatty acid profiles

  • Biochemical tests including ornithine and lysine decarboxylase activity

  • Acidification of sucrose

  • Beta-hemolysis

  • A recA gene-based PCR assay

Notably, B. ambifaria includes both environmental isolates with biocontrol properties and strains isolated from cystic fibrosis patients, raising concerns about the potential pathogenicity of environmental strains .

What structural features characterize UbiA family prenyltransferases?

The structural understanding of UbiA family prenyltransferases has been advanced through studies on homologous proteins, particularly AfUbiA from Archaeoglobus fulgidus . Key structural features include:

  • Membrane embedding: UbiA prenyltransferases are integral membrane proteins with multiple transmembrane helices that anchor the protein within the lipid bilayer.

  • Active site chamber: These enzymes contain a sealed amphipathic chamber that houses the active site, protecting reaction intermediates from the aqueous environment.

  • Magnesium binding site: The active site includes conserved residues that coordinate Mg²⁺ ions, which are essential for catalytic activity.

  • Substrate binding pockets: Specific regions accommodate the binding of both the prenyl donor (isoprenyl diphosphate) and the aromatic acceptor molecule.

  • Conserved functional motifs: Critical amino acid residues involved in substrate binding and catalysis are conserved across the UbiA family .

The structure of AfUbiA has been solved in both unliganded form and bound to Mg²⁺ and different isoprenyl diphosphates, providing insights into the reaction mechanism . Disease-causing mutations in the human homolog UBIAD1 cluster around the active site, suggesting a conserved catalytic mechanism across evolutionary distant members of this family .

What are optimal storage conditions for recombinant Burkholderia ambifaria ubiA?

For recombinant B. ambifaria 4-hydroxybenzoate octaprenyltransferase, the following storage conditions are recommended:

  • Long-term storage: Store at -20°C; for extended storage, -80°C is recommended to maintain protein stability and activity.

  • Storage buffer: A Tris-based buffer containing 50% glycerol, optimized specifically for this protein, helps maintain structural integrity during freeze-thaw cycles.

  • Working aliquots: Store at 4°C for up to one week to minimize freeze-thaw damage.

  • Handling precautions: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity .

These storage recommendations reflect standard practices for maintaining the stability and activity of recombinant membrane proteins, which are often particularly sensitive to storage conditions due to their hydrophobic nature.

What assays can be used to measure 4-hydroxybenzoate octaprenyltransferase activity?

Several methodological approaches can be employed to assess the enzymatic activity of 4-hydroxybenzoate octaprenyltransferase:

  • Radioactive substrate assays:

    • Using ¹⁴C-labeled isoprenyl diphosphate or 4-hydroxybenzoate

    • Measuring incorporation of radioactivity into the prenylated product

    • Separation by thin-layer chromatography or HPLC

  • HPLC-based methods:

    • Detection of the prenylated product formation

    • Monitoring the decrease in substrate concentration

    • Using UV-visible or fluorescence detection

  • Coupled enzyme assays:

    • Measuring pyrophosphate release as a reaction byproduct

    • Coupling with pyrophosphatase and detection of phosphate using colorimetric methods

  • Mass spectrometry:

    • Direct detection of product formation using LC-MS/MS

    • Allowing for precise identification of prenylated intermediates and products

  • In vivo complementation:

    • Functional complementation of ubiA-deficient bacterial strains

    • Measuring restoration of respiratory capacity or ubiquinone levels

Each of these methods offers different advantages in terms of sensitivity, specificity, and compatibility with membrane protein analysis. The choice of assay depends on the specific research question and available instrumentation.

What is the role of Mg²⁺ in the catalytic mechanism of UbiA prenyltransferases?

Magnesium ions (Mg²⁺) play a critical role in the catalytic mechanism of UbiA prenyltransferases:

  • Substrate coordination: Mg²⁺ ions coordinate the diphosphate moiety of the isoprenyl diphosphate substrate, neutralizing its negative charge and positioning it correctly within the active site.

  • Activation of the leaving group: The coordination by Mg²⁺ facilitates the departure of the pyrophosphate leaving group during catalysis.

  • Transition state stabilization: Mg²⁺ helps stabilize the transition state during the prenyl transfer reaction.

  • Structural integrity: The binding of Mg²⁺ contributes to the proper conformation of the active site.

Structural studies on AfUbiA, a homolog of B. ambifaria ubiA, have revealed specific residues involved in coordinating Mg²⁺ within the active site . The Mg²⁺-dependent mechanism is conserved across the UbiA family, including in human homologs like UBIAD1 .

Experimental evidence from functional assays on MenA, another UbiA family member from E. coli, has verified the importance of residues involved in Mg²⁺ binding, confirming the essential role of these metal ions in catalysis .

How do mutations in ubiA affect enzyme activity and bacterial physiology?

Mutations in ubiA can have significant impacts on enzyme activity and bacterial physiology:

  • Catalytic efficiency: Mutations in residues involved in substrate binding or Mg²⁺ coordination can directly impair catalytic efficiency, reducing the rate of prenyl transfer.

  • Substrate specificity: Certain mutations may alter substrate preference, affecting the enzyme's ability to recognize specific isoprenyl diphosphates or aromatic acceptors.

  • Respiratory chain function: Since ubiA is essential for ubiquinone biosynthesis, mutations can lead to reduced ubiquinone levels, impairing electron transport chain function and cellular respiration.

  • Growth defects: Severe mutations can cause growth defects, particularly under conditions requiring respiratory metabolism.

  • Antibiotic susceptibility: Changes in ubiquinone production can alter membrane properties and potentially affect antibiotic susceptibility profiles.

Studies on human UBIAD1, a homolog of bacterial ubiA, have shown that disease-causing mutations cluster around the active site, suggesting they disrupt normal catalytic function . By extension, similar mutations in bacterial ubiA would likely affect enzymatic activity in comparable ways.

How can structural knowledge of UbiA homologs inform drug development against B. ambifaria?

The structural insights gained from UbiA homologs provide valuable opportunities for rational drug design targeting B. ambifaria:

  • Active site targeting: The sealed amphipathic chamber that houses the active site offers a specific target for inhibitor design. Compounds that can access this chamber and interfere with substrate binding or catalysis could serve as selective inhibitors.

  • Mg²⁺ coordination disruption: Molecules designed to interfere with Mg²⁺ coordination could potentially inhibit enzyme activity, as Mg²⁺ is essential for catalysis .

  • Transition state analogs: Based on the proposed reaction mechanism, transition state analogs could be designed to bind with high affinity to the active site.

  • Species-specific targeting: While the catalytic core is conserved, differences between bacterial and human homologs could be exploited to design inhibitors with selectivity for bacterial enzymes, minimizing off-target effects.

  • Structure-based virtual screening: The availability of three-dimensional structures of UbiA homologs enables virtual screening approaches to identify potential inhibitors from compound libraries.

The resolution of structures for UbiA homologs in different states (unliganded and bound to substrates) provides templates for homology modeling of B. ambifaria ubiA, facilitating structure-based drug design efforts .

What methods can be used to study membrane-embedded prenyltransferases like ubiA in vitro?

Studying membrane proteins like ubiA presents unique challenges that require specialized techniques:

  • Protein expression and purification:

    • Bacterial expression systems (E. coli, B. subtilis)

    • Yeast expression (P. pastoris, S. cerevisiae)

    • Cell-free expression systems

    • Use of fusion tags to aid solubility and purification

    • Detergent screening for optimal extraction and stability

  • Structural characterization:

    • X-ray crystallography with lipidic cubic phase (LCP) crystallization

    • Cryo-electron microscopy (cryo-EM)

    • Solid-state NMR spectroscopy

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

  • Functional reconstitution:

    • Liposome reconstitution

    • Nanodiscs for a native-like membrane environment

    • Proteoliposomes for activity assays

  • Biophysical characterization:

    • Differential scanning fluorimetry to assess thermal stability

    • Circular dichroism to analyze secondary structure

    • Surface plasmon resonance for binding studies

    • Microscale thermophoresis for ligand binding analysis

  • Activity assays in membrane mimetics:

    • Detergent micelles

    • Bicelles

    • Amphipols

    • Styrene-maleic acid lipid particles (SMALPs)

The successful structural characterization of AfUbiA employed X-ray crystallography techniques optimized for membrane proteins, providing a methodological framework that could be adapted for B. ambifaria ubiA .

How does the antibiotic potentiation mechanism of baicalin hydrate relate to ubiA function in Burkholderia species?

The potentiation of antibiotics by baicalin hydrate (BH) in Burkholderia species involves complex interactions with cellular systems, including potential relationships with ubiA function:

  • ROS modulation: BH treatment increases ROS production in Burkholderia cenocepacia biofilms, which becomes even more pronounced when combined with antibiotics like tobramycin (TOB) . The H2DCFDA assay has demonstrated a 2-fold increase in ROS with TOB alone and another 2-fold increase when combined with BH .

  • Oxidative stress response: The potentiating effect of BH appears to involve modulation of the oxidative stress response . Since ubiA is involved in ubiquinone biosynthesis, which plays a role in managing oxidative stress, there may be an indirect relationship.

  • Strain-dependent effects: The potentiating effect of BH varies across Burkholderia species and strains. For B. ambifaria LMG 19182, increased susceptibility was observed towards gentamicin and neomycin when combined with BH .

  • Quorum sensing independence: Experiments with a triple QS mutant showed that BH's effect on ROS production persists even in the absence of functional QS systems, suggesting multiple mechanisms of action .

The experimental table below summarizes ROS production in B. cenocepacia under different treatment conditions:

TreatmentROS Production (Relative Fluorescence)Fold Change vs. ControlFold Change vs. TOB Alone
Control1.0 (baseline)--
TOB~2.02.0×-
TOB + BH~4.04.0×2.0×

These data indicate that while the precise mechanism involving ubiA remains to be elucidated, the potentiating effect likely involves disruption of oxidative stress management systems that intersect with ubiquinone metabolism .

What are the clinical implications of B. ambifaria's dual role as a potential biocontrol agent and opportunistic pathogen?

The dual nature of B. ambifaria as both a potential biocontrol agent and an opportunistic pathogen raises significant clinical and agricultural considerations:

  • Biocontrol applications: Environmental B. ambifaria strains have attracted interest due to their biocontrol properties, potentially offering sustainable alternatives to chemical pesticides .

  • Clinical concerns: The isolation of B. ambifaria from cystic fibrosis (CF) patients raises serious concerns about the potential pathogenicity of environmental strains .

  • Risk assessment framework: The dual role necessitates comprehensive risk assessment frameworks before deploying B. ambifaria strains for biocontrol applications.

  • Virulence factors: Understanding the specific virulence factors, including the potential role of metabolic enzymes like ubiA, is crucial for distinguishing between harmless environmental strains and potential pathogens.

  • Taxonomic classification: The polyphasic taxonomic approach used to characterize B. ambifaria has provided tools for accurate identification, which is essential for both clinical diagnostics and environmental monitoring .

The scientific consensus suggests caution in the large-scale use of B. ambifaria or other members of the B. cepacia complex for biocontrol until more is known about their potential pathogenic mechanisms . This highlights the importance of research on proteins like ubiA that may contribute to both beneficial traits and pathogenicity.

What experimental approaches can elucidate the role of ubiA in B. ambifaria pathogenicity and biofilm formation?

To investigate ubiA's role in B. ambifaria pathogenicity and biofilm formation, several experimental approaches can be employed:

  • Gene knockout/knockdown studies:

    • CRISPR-Cas9 genome editing to create ubiA deletion mutants

    • Inducible antisense RNA to achieve conditional knockdown

    • Complementation studies to verify phenotypic changes

  • Biofilm assays:

    • Crystal violet staining for quantifying biofilm formation

    • Confocal microscopy with live/dead staining to assess biofilm structure

    • Flow cell systems to study biofilm development under dynamic conditions

  • Virulence models:

    • Galleria mellonella infection model

    • Murine pulmonary infection models

    • Cell culture invasion and persistence assays

  • Oxidative stress response:

    • H2DCFDA assay to measure ROS production under different conditions

    • qRT-PCR to analyze expression of oxidative stress response genes

    • Proteomic analysis to identify changes in protein expression

  • Antibiotic susceptibility testing:

    • Minimum inhibitory concentration (MIC) determination

    • Biofilm susceptibility assays

    • Combinatorial testing with antibiotic potentiators like baicalin hydrate

These approaches would provide comprehensive insights into how ubiA contributes to B. ambifaria physiology, particularly in contexts relevant to its potential pathogenicity and environmental persistence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.